MELO3C024893 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGAATGTTGTCTACTAAAGCTAGCCATGATTCTCGTGGACAAAATCCCTCCTACTTCTTTGGATGGCAAGAGTACGAGAAGAACCCTTATCACCCTACTCAAAACCCCACCGGCATTATCCAAATGGCTCTTGCCGAAAACAAGTAA ATGGGAATGTTGTCTACTAAAGCTAGCCATGATTCTCGTGGACAAAATCCCTCCTACTTCTTTGGATGGCAAGAGTACGAGAAGAACCCTTATCACCCTACTCAAAACCCCACCGGCATTATCCAAATGGCTCTTGCCGAAAACAAGTAA ATGGGAATGTTGTCTACTAAAGCTAGCCATGATTCTCGTGGACAAAATCCCTCCTACTTCTTTGGATGGCAAGAGTACGAGAAGAACCCTTATCACCCTACTCAAAACCCCACCGGCATTATCCAAATGGCTCTTGCCGAAAACAAGTAA MGMLSTKASHDSRGQNPSYFFGWQEYEKNPYHPTQNPTGIIQMALAENK Homology
BLAST of MELO3C024893 vs. NCBI nr
Match: KAA0060976.1 (1-aminocyclopropane-1-carboxylate synthase CMA101-like isoform X1 [Cucumis melo var. makuwa]) HSP 1 Score: 97.4 bits (241), Expect = 3.5e-17 Identity = 43/49 (87.76%), Postives = 45/49 (91.84%), Query Frame = 0
BLAST of MELO3C024893 vs. NCBI nr
Match: XP_038886265.1 (1-aminocyclopropane-1-carboxylate synthase CMA101-like [Benincasa hispida]) HSP 1 Score: 96.7 bits (239), Expect = 6.0e-17 Identity = 43/49 (87.76%), Postives = 45/49 (91.84%), Query Frame = 0
BLAST of MELO3C024893 vs. NCBI nr
Match: XP_008445556.2 (PREDICTED: 1-aminocyclopropane-1-carboxylate synthase CMA101-like isoform X1 [Cucumis melo]) HSP 1 Score: 95.9 bits (237), Expect = 1.0e-16 Identity = 42/49 (85.71%), Postives = 44/49 (89.80%), Query Frame = 0
BLAST of MELO3C024893 vs. NCBI nr
Match: ALN38792.1 (ACS11 [Cucumis melo]) HSP 1 Score: 95.9 bits (237), Expect = 1.0e-16 Identity = 42/49 (85.71%), Postives = 44/49 (89.80%), Query Frame = 0
BLAST of MELO3C024893 vs. NCBI nr
Match: XP_022131648.1 (1-aminocyclopropane-1-carboxylate synthase CMA101-like [Momordica charantia]) HSP 1 Score: 93.6 bits (231), Expect = 5.1e-16 Identity = 41/49 (83.67%), Postives = 45/49 (91.84%), Query Frame = 0
BLAST of MELO3C024893 vs. ExPASy Swiss-Prot
Match: Q9T065 (1-aminocyclopropane-1-carboxylate synthase 8 OS=Arabidopsis thaliana OX=3702 GN=ACS8 PE=1 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 1.6e-12 Identity = 32/49 (65.31%), Postives = 40/49 (81.63%), Query Frame = 0
BLAST of MELO3C024893 vs. ExPASy Swiss-Prot
Match: Q00257 (1-aminocyclopropane-1-carboxylate synthase CMA101 OS=Cucurbita maxima OX=3661 GN=ACS2 PE=2 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 2.1e-12 Identity = 32/49 (65.31%), Postives = 38/49 (77.55%), Query Frame = 0
BLAST of MELO3C024893 vs. ExPASy Swiss-Prot
Match: Q42881 (1-aminocyclopropane-1-carboxylate synthase 3 OS=Solanum lycopersicum OX=4081 GN=ACS3 PE=1 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 2.7e-12 Identity = 33/49 (67.35%), Postives = 38/49 (77.55%), Query Frame = 0
BLAST of MELO3C024893 vs. ExPASy Swiss-Prot
Match: A2XLL2 (1-aminocyclopropane-1-carboxylate synthase 1 OS=Oryza sativa subsp. indica OX=39946 GN=ACC1 PE=2 SV=2) HSP 1 Score: 70.9 bits (172), Expect = 4.7e-12 Identity = 31/47 (65.96%), Postives = 37/47 (78.72%), Query Frame = 0
BLAST of MELO3C024893 vs. ExPASy Swiss-Prot
Match: Q10DK7 (1-aminocyclopropane-1-carboxylate synthase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=ACC1 PE=2 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 4.7e-12 Identity = 31/47 (65.96%), Postives = 37/47 (78.72%), Query Frame = 0
BLAST of MELO3C024893 vs. ExPASy TrEMBL
Match: A0A5A7V392 (1-aminocyclopropane-1-carboxylate synthase CMA101-like isoform X1 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold501G001110 PE=3 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 1.7e-17 Identity = 43/49 (87.76%), Postives = 45/49 (91.84%), Query Frame = 0
BLAST of MELO3C024893 vs. ExPASy TrEMBL
Match: A0A1S3BD08 (1-aminocyclopropane-1-carboxylate synthase CMA101-like isoform X1 OS=Cucumis melo OX=3656 GN=LOC103488536 PE=3 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 5.0e-17 Identity = 42/49 (85.71%), Postives = 44/49 (89.80%), Query Frame = 0
BLAST of MELO3C024893 vs. ExPASy TrEMBL
Match: A0A0S2C3P7 (ACS11 OS=Cucumis melo OX=3656 PE=3 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 5.0e-17 Identity = 42/49 (85.71%), Postives = 44/49 (89.80%), Query Frame = 0
BLAST of MELO3C024893 vs. ExPASy TrEMBL
Match: A0A6J1BU08 (1-aminocyclopropane-1-carboxylate synthase CMA101-like OS=Momordica charantia OX=3673 GN=LOC111004776 PE=3 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 2.5e-16 Identity = 41/49 (83.67%), Postives = 45/49 (91.84%), Query Frame = 0
BLAST of MELO3C024893 vs. ExPASy TrEMBL
Match: Q71T07 (1-aminocyclopropane-1-carboxylate synthase OS=Momordica charantia OX=3673 GN=ACS2 PE=3 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 2.5e-16 Identity = 41/49 (83.67%), Postives = 45/49 (91.84%), Query Frame = 0
BLAST of MELO3C024893 vs. TAIR 10
Match: AT4G37770.1 (1-amino-cyclopropane-1-carboxylate synthase 8 ) HSP 1 Score: 72.4 bits (176), Expect = 1.1e-13 Identity = 32/49 (65.31%), Postives = 40/49 (81.63%), Query Frame = 0
BLAST of MELO3C024893 vs. TAIR 10
Match: AT4G08040.1 (1-aminocyclopropane-1-carboxylate synthase 11 ) HSP 1 Score: 68.9 bits (167), Expect = 1.3e-12 Identity = 30/47 (63.83%), Postives = 37/47 (78.72%), Query Frame = 0
BLAST of MELO3C024893 vs. TAIR 10
Match: AT2G22810.1 (1-aminocyclopropane-1-carboxylate synthase 4 ) HSP 1 Score: 68.2 bits (165), Expect = 2.1e-12 Identity = 32/49 (65.31%), Postives = 37/49 (75.51%), Query Frame = 0
BLAST of MELO3C024893 vs. TAIR 10
Match: AT5G65800.1 (ACC synthase 5 ) HSP 1 Score: 67.4 bits (163), Expect = 3.7e-12 Identity = 29/49 (59.18%), Postives = 36/49 (73.47%), Query Frame = 0
BLAST of MELO3C024893 vs. TAIR 10
Match: AT3G49700.1 (1-aminocyclopropane-1-carboxylate synthase 9 ) HSP 1 Score: 66.6 bits (161), Expect = 6.2e-12 Identity = 29/49 (59.18%), Postives = 36/49 (73.47%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|