MELO3C024891 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGCAAGCTAAAACGCTGAATTTACGAGTCAAAGGGATTATGATTACGAACCCATCCAACCCCTTGGACACCACATTAAGCCAGAGAGAGCATAACTCAGTGGTTGATTTCGCTACTACCAACGCCATCCACATCGTGAGCGACGAGATATATTCTCTACAGTTTTTTAGCACCCAAAATTTTGAAACGTCATGGACGCGAACTCACAAAAATTCCCAATTTGGGACCAAATCCACTTGGTGTACGACTTATCCACAGATCTAG ATGGAGCAAGCTAAAACGCTGAATTTACGAGTCAAAGGGATTATGATTACGAACCCATCCAACCCCTTGGACACCACATTAAGCCAGAGAGAGCATAACTCAGTGGTTGATTTCGCTACTACCAACGCCATCCACATCGTGAGCGACGAGATATATTCTCTACAGTTTTTTAGCACCCAAAATTTTGAAACGTCATGGACGCGAACTCACAAAAATTCCCAATTTGGGACCAAATCCACTTGGTGTACGACTTATCCACAGATCTAG ATGGAGCAAGCTAAAACGCTGAATTTACGAGTCAAAGGGATTATGATTACGAACCCATCCAACCCCTTGGACACCACATTAAGCCAGAGAGAGCATAACTCAGTGGTTGATTTCGCTACTACCAACGCCATCCACATCGTGAGCGACGAGATATATTCTCTACAGTTTTTTAGCACCCAAAATTTTGAAACGTCATGGACGCGAACTCACAAAAATTCCCAATTTGGGACCAAATCCACTTGGTGTACGACTTATCCACAGATCTAG MEQAKTLNLRVKGIMITNPSNPLDTTLSQREHNSVVDFATTNAIHIVSDEIYSLQFFSTQNFETSWTRTHKNSQFGTKSTWCTTYPQI Homology
BLAST of MELO3C024891 vs. NCBI nr
Match: ALN38791.1 (ACS11 [Cucumis sativus]) HSP 1 Score: 100.1 bits (248), Expect = 9.8e-18 Identity = 52/64 (81.25%), Postives = 55/64 (85.94%), Query Frame = 0
BLAST of MELO3C024891 vs. NCBI nr
Match: XP_004142909.2 (1-aminocyclopropane-1-carboxylate synthase 3 [Cucumis sativus] >KGN62672.2 hypothetical protein Csa_018705 [Cucumis sativus]) HSP 1 Score: 100.1 bits (248), Expect = 9.8e-18 Identity = 52/64 (81.25%), Postives = 55/64 (85.94%), Query Frame = 0
BLAST of MELO3C024891 vs. NCBI nr
Match: ALN38792.1 (ACS11 [Cucumis melo]) HSP 1 Score: 94.7 bits (234), Expect = 4.1e-16 Identity = 50/64 (78.12%), Postives = 52/64 (81.25%), Query Frame = 0
BLAST of MELO3C024891 vs. NCBI nr
Match: KAA0060976.1 (1-aminocyclopropane-1-carboxylate synthase CMA101-like isoform X1 [Cucumis melo var. makuwa]) HSP 1 Score: 94.7 bits (234), Expect = 4.1e-16 Identity = 50/64 (78.12%), Postives = 52/64 (81.25%), Query Frame = 0
BLAST of MELO3C024891 vs. NCBI nr
Match: XP_008445556.2 (PREDICTED: 1-aminocyclopropane-1-carboxylate synthase CMA101-like isoform X1 [Cucumis melo]) HSP 1 Score: 92.8 bits (229), Expect = 1.6e-15 Identity = 49/64 (76.56%), Postives = 52/64 (81.25%), Query Frame = 0
BLAST of MELO3C024891 vs. ExPASy Swiss-Prot
Match: Q37001 (1-aminocyclopropane-1-carboxylate synthase 5 OS=Arabidopsis thaliana OX=3702 GN=ACS5 PE=1 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 6.4e-12 Identity = 33/61 (54.10%), Postives = 47/61 (77.05%), Query Frame = 0
BLAST of MELO3C024891 vs. ExPASy Swiss-Prot
Match: Q9M2Y8 (1-aminocyclopropane-1-carboxylate synthase 9 OS=Arabidopsis thaliana OX=3702 GN=ACS9 PE=1 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 1.1e-11 Identity = 33/61 (54.10%), Postives = 47/61 (77.05%), Query Frame = 0
BLAST of MELO3C024891 vs. ExPASy Swiss-Prot
Match: Q00257 (1-aminocyclopropane-1-carboxylate synthase CMA101 OS=Cucurbita maxima OX=3661 GN=ACS2 PE=2 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 1.4e-11 Identity = 33/61 (54.10%), Postives = 45/61 (73.77%), Query Frame = 0
BLAST of MELO3C024891 vs. ExPASy Swiss-Prot
Match: Q43309 (1-aminocyclopropane-1-carboxylate synthase 4 OS=Arabidopsis thaliana OX=3702 GN=ACS4 PE=1 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 2.4e-11 Identity = 38/62 (61.29%), Postives = 45/62 (72.58%), Query Frame = 0
BLAST of MELO3C024891 vs. ExPASy Swiss-Prot
Match: Q9T065 (1-aminocyclopropane-1-carboxylate synthase 8 OS=Arabidopsis thaliana OX=3702 GN=ACS8 PE=1 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 2.4e-11 Identity = 33/61 (54.10%), Postives = 45/61 (73.77%), Query Frame = 0
BLAST of MELO3C024891 vs. ExPASy TrEMBL
Match: A0A0A0LKW1 (ACS11 OS=Cucumis sativus OX=3659 GN=Csa_2G353460 PE=3 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 4.7e-18 Identity = 52/64 (81.25%), Postives = 55/64 (85.94%), Query Frame = 0
BLAST of MELO3C024891 vs. ExPASy TrEMBL
Match: A0A5A7V392 (1-aminocyclopropane-1-carboxylate synthase CMA101-like isoform X1 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold501G001110 PE=3 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 2.0e-16 Identity = 50/64 (78.12%), Postives = 52/64 (81.25%), Query Frame = 0
BLAST of MELO3C024891 vs. ExPASy TrEMBL
Match: A0A0S2C3P7 (ACS11 OS=Cucumis melo OX=3656 PE=3 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 2.0e-16 Identity = 50/64 (78.12%), Postives = 52/64 (81.25%), Query Frame = 0
BLAST of MELO3C024891 vs. ExPASy TrEMBL
Match: A0A1S4DVP5 (1-aminocyclopropane-1-carboxylate synthase CMA101-like isoform X2 OS=Cucumis melo OX=3656 GN=LOC103488536 PE=3 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 7.6e-16 Identity = 49/64 (76.56%), Postives = 52/64 (81.25%), Query Frame = 0
BLAST of MELO3C024891 vs. ExPASy TrEMBL
Match: A0A1S3BD08 (1-aminocyclopropane-1-carboxylate synthase CMA101-like isoform X1 OS=Cucumis melo OX=3656 GN=LOC103488536 PE=3 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 7.6e-16 Identity = 49/64 (76.56%), Postives = 52/64 (81.25%), Query Frame = 0
BLAST of MELO3C024891 vs. TAIR 10
Match: AT5G65800.1 (ACC synthase 5 ) HSP 1 Score: 71.2 bits (173), Expect = 4.5e-13 Identity = 33/61 (54.10%), Postives = 47/61 (77.05%), Query Frame = 0
BLAST of MELO3C024891 vs. TAIR 10
Match: AT3G49700.1 (1-aminocyclopropane-1-carboxylate synthase 9 ) HSP 1 Score: 70.5 bits (171), Expect = 7.8e-13 Identity = 33/61 (54.10%), Postives = 47/61 (77.05%), Query Frame = 0
BLAST of MELO3C024891 vs. TAIR 10
Match: AT2G22810.1 (1-aminocyclopropane-1-carboxylate synthase 4 ) HSP 1 Score: 69.3 bits (168), Expect = 1.7e-12 Identity = 38/62 (61.29%), Postives = 45/62 (72.58%), Query Frame = 0
BLAST of MELO3C024891 vs. TAIR 10
Match: AT4G37770.1 (1-amino-cyclopropane-1-carboxylate synthase 8 ) HSP 1 Score: 69.3 bits (168), Expect = 1.7e-12 Identity = 33/61 (54.10%), Postives = 45/61 (73.77%), Query Frame = 0
BLAST of MELO3C024891 vs. TAIR 10
Match: AT4G08040.1 (1-aminocyclopropane-1-carboxylate synthase 11 ) HSP 1 Score: 59.3 bits (142), Expect = 1.8e-09 Identity = 34/75 (45.33%), Postives = 47/75 (62.67%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|