![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MELO3C024487 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTAACGGGCACCAACCACTGTCCGCCCAATTACAACCTCCCTAGAGACAATGGTGGATGGTGCAATCCCCCACTCGAGCATTTCGACATTGCGAAGCCTGTTTTCCTCAACATTGCTGAGTTCAAGGCTGGCATTGTCCCTGTCACTTACCGCAGGTAT ATGGTAACGGGCACCAACCACTGTCCGCCCAATTACAACCTCCCTAGAGACAATGGTGGATGGTGCAATCCCCCACTCGAGCATTTCGACATTGCGAAGCCTGTTTTCCTCAACATTGCTGAGTTCAAGGCTGGCATTGTCCCTGTCACTTACCGCAGGTAT ATGGTAACGGGCACCAACCACTGTCCGCCCAATTACAACCTCCCTAGAGACAATGGTGGATGGTGCAATCCCCCACTCGAGCATTTCGACATTGCGAAGCCTGTTTTCCTCAACATTGCTGAGTTCAAGGCTGGCATTGTCCCTGTCACTTACCGCAGGTAT MVTGTNHCPPNYNLPRDNGGWCNPPLEHFDIAKPVFLNIAEFKAGIVPVTYRRY Homology
BLAST of MELO3C024487 vs. NCBI nr
Match: XP_008462508.1 (PREDICTED: expansin-A9-like [Cucumis melo]) HSP 1 Score: 124.0 bits (310), Expect = 3.9e-25 Identity = 52/53 (98.11%), Postives = 53/53 (100.00%), Query Frame = 0
BLAST of MELO3C024487 vs. NCBI nr
Match: KAE8647412.1 (hypothetical protein Csa_003212 [Cucumis sativus]) HSP 1 Score: 118.6 bits (296), Expect = 1.6e-23 Identity = 49/53 (92.45%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MELO3C024487 vs. NCBI nr
Match: XP_004143366.1 (expansin-A3 [Cucumis sativus]) HSP 1 Score: 118.6 bits (296), Expect = 1.6e-23 Identity = 49/53 (92.45%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MELO3C024487 vs. NCBI nr
Match: KAG7034536.1 (Expansin-A9, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 109.8 bits (273), Expect = 7.6e-21 Identity = 42/53 (79.25%), Postives = 49/53 (92.45%), Query Frame = 0
BLAST of MELO3C024487 vs. NCBI nr
Match: KAG6604386.1 (Expansin-A32, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 109.8 bits (273), Expect = 7.6e-21 Identity = 42/53 (79.25%), Postives = 49/53 (92.45%), Query Frame = 0
BLAST of MELO3C024487 vs. ExPASy Swiss-Prot
Match: Q852A1 (Expansin-A7 OS=Oryza sativa subsp. japonica OX=39947 GN=EXPA7 PE=2 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 6.7e-20 Identity = 38/53 (71.70%), Postives = 46/53 (86.79%), Query Frame = 0
BLAST of MELO3C024487 vs. ExPASy Swiss-Prot
Match: Q9LZ99 (Expansin-A9 OS=Arabidopsis thaliana OX=3702 GN=EXPA9 PE=2 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 2.5e-19 Identity = 37/53 (69.81%), Postives = 46/53 (86.79%), Query Frame = 0
BLAST of MELO3C024487 vs. ExPASy Swiss-Prot
Match: O48818 (Expansin-A4 OS=Arabidopsis thaliana OX=3702 GN=EXPA4 PE=1 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 7.4e-19 Identity = 37/53 (69.81%), Postives = 44/53 (83.02%), Query Frame = 0
BLAST of MELO3C024487 vs. ExPASy Swiss-Prot
Match: A2Y5R6 (Expansin-A4 OS=Oryza sativa subsp. indica OX=39946 GN=EXPA4 PE=2 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 1.6e-18 Identity = 36/52 (69.23%), Postives = 45/52 (86.54%), Query Frame = 0
BLAST of MELO3C024487 vs. ExPASy Swiss-Prot
Match: Q0DHB7 (Expansin-A4 OS=Oryza sativa subsp. japonica OX=39947 GN=EXPA4 PE=2 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 1.6e-18 Identity = 36/52 (69.23%), Postives = 45/52 (86.54%), Query Frame = 0
BLAST of MELO3C024487 vs. ExPASy TrEMBL
Match: A0A1S3CH49 (Expansin OS=Cucumis melo OX=3656 GN=LOC103500844 PE=3 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 1.9e-25 Identity = 52/53 (98.11%), Postives = 53/53 (100.00%), Query Frame = 0
BLAST of MELO3C024487 vs. ExPASy TrEMBL
Match: A0A0A0KIG7 (Expansin OS=Cucumis sativus OX=3659 GN=Csa_6G448160 PE=3 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 7.9e-24 Identity = 49/53 (92.45%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MELO3C024487 vs. ExPASy TrEMBL
Match: A0A6J1ED76 (Expansin OS=Cucurbita moschata OX=3662 GN=LOC111433099 PE=3 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 3.7e-21 Identity = 42/53 (79.25%), Postives = 49/53 (92.45%), Query Frame = 0
BLAST of MELO3C024487 vs. ExPASy TrEMBL
Match: A0A2P6RB60 (Expansin OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr3g0470931 PE=3 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 1.1e-20 Identity = 45/52 (86.54%), Postives = 47/52 (90.38%), Query Frame = 0
BLAST of MELO3C024487 vs. ExPASy TrEMBL
Match: A0A6J1ISW4 (Expansin OS=Cucurbita maxima OX=3661 GN=LOC111478120 PE=3 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 2.4e-20 Identity = 41/53 (77.36%), Postives = 48/53 (90.57%), Query Frame = 0
BLAST of MELO3C024487 vs. TAIR 10
Match: AT5G02260.1 (expansin A9 ) HSP 1 Score: 95.1 bits (235), Expect = 1.8e-20 Identity = 37/53 (69.81%), Postives = 46/53 (86.79%), Query Frame = 0
BLAST of MELO3C024487 vs. TAIR 10
Match: AT2G39700.1 (expansin A4 ) HSP 1 Score: 93.6 bits (231), Expect = 5.2e-20 Identity = 37/53 (69.81%), Postives = 44/53 (83.02%), Query Frame = 0
BLAST of MELO3C024487 vs. TAIR 10
Match: AT1G26770.1 (expansin A10 ) HSP 1 Score: 91.7 bits (226), Expect = 2.0e-19 Identity = 37/53 (69.81%), Postives = 45/53 (84.91%), Query Frame = 0
BLAST of MELO3C024487 vs. TAIR 10
Match: AT1G26770.2 (expansin A10 ) HSP 1 Score: 91.7 bits (226), Expect = 2.0e-19 Identity = 37/53 (69.81%), Postives = 45/53 (84.91%), Query Frame = 0
BLAST of MELO3C024487 vs. TAIR 10
Match: AT3G55500.1 (expansin A16 ) HSP 1 Score: 91.7 bits (226), Expect = 2.0e-19 Identity = 37/52 (71.15%), Postives = 42/52 (80.77%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|