MELO3C023838 (gene) Melon (DHL92) v4
|
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGCTACGTCGGGTGCTTGTAAAATTCACAAAAATGTTGAATTGGGAGAGAGCCGCTAACAAACTATTTGAGTTGAACTCTGATGAAGGTGGCTACTATGTCTTGTTTGTGAGTATTTATGAATCTGCTTCAAAATGGAATAAGGTAGCTGAAGTGAAAAAAGCAATATAAATGGTGCTACGTCGGGTGCTTGTAAAATTCACAAAAATGTTGAATTGGGAGAGAGCCGCTAACAAACTATTTGAGTTGAACTCTGATGAAGGTGGCTACTATGTCTTGTTTGTGAGTATTTATGAATCTGCTTCAAAATGGAATAAGGTAGCTGAAGTGAAAAAAGCAATATAA ATGGTGCTACGTCGGGTGCTTGTAAAATTCACAAAAATGTTGAATTGGGAGAGAGCCGCTAACAAACTATTTGAGTTGAACTCTGATGAAGGTGGCTACTATGTCTTGTTTGTGAGTATTTATGAATCTGCTTCAAAATGGAATAAGGTAGCTGAAGTGAAAAAAGCAATATAA MVLRRVLVKFTKMLNWERAANKLFELNSDEGGYYVLFVSIYESASKWNKVAEVKKAI Homology
BLAST of MELO3C023838 vs. NCBI nr
Match: XP_008445930.1 (PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic [Cucumis melo] >KAA0034113.1 pentatricopeptide repeat-containing protein [Cucumis melo var. makuwa] >TYK15808.1 pentatricopeptide repeat-containing protein [Cucumis melo var. makuwa]) HSP 1 Score: 65.1 bits (157), Expect = 2.3e-07 Identity = 29/41 (70.73%), Postives = 35/41 (85.37%), Query Frame = 0
BLAST of MELO3C023838 vs. NCBI nr
Match: XP_038891367.1 (pentatricopeptide repeat-containing protein At1g11290, chloroplastic [Benincasa hispida]) HSP 1 Score: 64.7 bits (156), Expect = 3.0e-07 Identity = 29/41 (70.73%), Postives = 34/41 (82.93%), Query Frame = 0
BLAST of MELO3C023838 vs. NCBI nr
Match: XP_022967032.1 (pentatricopeptide repeat-containing protein At1g11290, chloroplastic isoform X1 [Cucurbita maxima]) HSP 1 Score: 63.2 bits (152), Expect = 8.6e-07 Identity = 27/41 (65.85%), Postives = 35/41 (85.37%), Query Frame = 0
BLAST of MELO3C023838 vs. NCBI nr
Match: XP_023541274.1 (pentatricopeptide repeat-containing protein At1g11290, chloroplastic [Cucurbita pepo subsp. pepo]) HSP 1 Score: 63.2 bits (152), Expect = 8.6e-07 Identity = 27/41 (65.85%), Postives = 35/41 (85.37%), Query Frame = 0
BLAST of MELO3C023838 vs. NCBI nr
Match: XP_022945178.1 (pentatricopeptide repeat-containing protein At1g11290, chloroplastic [Cucurbita moschata]) HSP 1 Score: 63.2 bits (152), Expect = 8.6e-07 Identity = 27/41 (65.85%), Postives = 35/41 (85.37%), Query Frame = 0
BLAST of MELO3C023838 vs. ExPASy Swiss-Prot
Match: Q3E6Q1 (Pentatricopeptide repeat-containing protein At1g11290, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PCMP-H40 PE=2 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 8.9e-07 Identity = 22/38 (57.89%), Postives = 30/38 (78.95%), Query Frame = 0
BLAST of MELO3C023838 vs. ExPASy Swiss-Prot
Match: Q9SN39 (Pentatricopeptide repeat-containing protein DOT4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DOT4 PE=2 SV=1) HSP 1 Score: 45.4 bits (106), Expect = 2.4e-04 Identity = 19/41 (46.34%), Postives = 26/41 (63.41%), Query Frame = 0
BLAST of MELO3C023838 vs. ExPASy TrEMBL
Match: A0A5D3CX30 (Pentatricopeptide repeat-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold35G003120 PE=3 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 1.1e-07 Identity = 29/41 (70.73%), Postives = 35/41 (85.37%), Query Frame = 0
BLAST of MELO3C023838 vs. ExPASy TrEMBL
Match: A0A1S3BEJ2 (pentatricopeptide repeat-containing protein At1g11290, chloroplastic OS=Cucumis melo OX=3656 GN=LOC103488809 PE=3 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 1.1e-07 Identity = 29/41 (70.73%), Postives = 35/41 (85.37%), Query Frame = 0
BLAST of MELO3C023838 vs. ExPASy TrEMBL
Match: A0A6J1HTZ0 (pentatricopeptide repeat-containing protein At1g11290, chloroplastic isoform X2 OS=Cucurbita maxima OX=3661 GN=LOC111466556 PE=3 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 4.2e-07 Identity = 27/41 (65.85%), Postives = 35/41 (85.37%), Query Frame = 0
BLAST of MELO3C023838 vs. ExPASy TrEMBL
Match: A0A6J1HPL9 (pentatricopeptide repeat-containing protein At1g11290, chloroplastic isoform X1 OS=Cucurbita maxima OX=3661 GN=LOC111466556 PE=3 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 4.2e-07 Identity = 27/41 (65.85%), Postives = 35/41 (85.37%), Query Frame = 0
BLAST of MELO3C023838 vs. ExPASy TrEMBL
Match: A0A6J1CD18 (pentatricopeptide repeat-containing protein At1g11290, chloroplastic isoform X1 OS=Momordica charantia OX=3673 GN=LOC111010091 PE=3 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 4.2e-07 Identity = 28/41 (68.29%), Postives = 35/41 (85.37%), Query Frame = 0
BLAST of MELO3C023838 vs. TAIR 10
Match: AT1G11290.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 53.5 bits (127), Expect = 6.4e-08 Identity = 22/38 (57.89%), Postives = 30/38 (78.95%), Query Frame = 0
BLAST of MELO3C023838 vs. TAIR 10
Match: AT4G18750.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 45.4 bits (106), Expect = 1.7e-05 Identity = 19/41 (46.34%), Postives = 26/41 (63.41%), Query Frame = 0
BLAST of MELO3C023838 vs. TAIR 10
Match: AT1G71490.1 (Tetratricopeptide repeat (TPR)-like superfamily protein ) HSP 1 Score: 42.4 bits (98), Expect = 1.5e-04 Identity = 19/44 (43.18%), Postives = 29/44 (65.91%), Query Frame = 0
BLAST of MELO3C023838 vs. TAIR 10
Match: AT3G49142.1 (Tetratricopeptide repeat (TPR)-like superfamily protein ) HSP 1 Score: 41.2 bits (95), Expect = 3.3e-04 Identity = 16/36 (44.44%), Postives = 25/36 (69.44%), Query Frame = 0
BLAST of MELO3C023838 vs. TAIR 10
Match: AT1G56690.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 40.8 bits (94), Expect = 4.3e-04 Identity = 22/39 (56.41%), Postives = 23/39 (58.97%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
|