MELO3C022506 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTAAATCTTACATCTTCCTTGTTCTCTACCTTCTTCCATAGGAATATTACCTCCAAACCCTTCTTCCAAAAATCCCTAAACAACCAAAAGTTACCATCTTTCACCACTTTTAACCACTTCCAGCTTCTCTTCAACATCCTTGACTCCGGTGGTGACGGCAAGATCTCGACGAAAGAGCTCAGTCAATTTCTCTATCGTTTAGGTTATAAAAAGCTGAAAGCTACAATGGAAGCTGAAGAAATGGTGAAGGAAATGGATTCAGACCGTGATGGATTCATCGAAATGGACGAATTTTTAGAGTGA ATGTTAAATCTTACATCTTCCTTGTTCTCTACCTTCTTCCATAGGAATATTACCTCCAAACCCTTCTTCCAAAAATCCCTAAACAACCAAAAGTTACCATCTTTCACCACTTTTAACCACTTCCAGCTTCTCTTCAACATCCTTGACTCCGGTGGTGACGGCAAGATCTCGACGAAAGAGCTCAGTCAATTTCTCTATCGTTTAGGTTATAAAAAGCTGAAAGCTACAATGGAAGCTGAAGAAATGGTGAAGGAAATGGATTCAGACCGTGATGGATTCATCGAAATGGACGAATTTTTAGAGTGA ATGTTAAATCTTACATCTTCCTTGTTCTCTACCTTCTTCCATAGGAATATTACCTCCAAACCCTTCTTCCAAAAATCCCTAAACAACCAAAAGTTACCATCTTTCACCACTTTTAACCACTTCCAGCTTCTCTTCAACATCCTTGACTCCGGTGGTGACGGCAAGATCTCGACGAAAGAGCTCAGTCAATTTCTCTATCGTTTAGGTTATAAAAAGCTGAAAGCTACAATGGAAGCTGAAGAAATGGTGAAGGAAATGGATTCAGACCGTGATGGATTCATCGAAATGGACGAATTTTTAGAGTGA MLNLTSSLFSTFFHRNITSKPFFQKSLNNQKLPSFTTFNHFQLLFNILDSGGDGKISTKELSQFLYRLGYKKLKATMEAEEMVKEMDSDRDGFIEMDEFLE Homology
BLAST of MELO3C022506 vs. ExPASy Swiss-Prot
Match: Q0DJV6 (Probable calcium-binding protein CML18 OS=Oryza sativa subsp. japonica OX=39947 GN=CML18 PE=2 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 6.7e-05 Identity = 26/56 (46.43%), Postives = 34/56 (60.71%), Query Frame = 0
BLAST of MELO3C022506 vs. ExPASy Swiss-Prot
Match: Q9FIH9 (Calcium-binding protein CML37 OS=Arabidopsis thaliana OX=3702 GN=CML37 PE=1 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 6.7e-05 Identity = 28/77 (36.36%), Postives = 44/77 (57.14%), Query Frame = 0
BLAST of MELO3C022506 vs. ExPASy Swiss-Prot
Match: P80322 (Troponin C OS=Branchiostoma lanceolatum OX=7740 PE=1 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 6.7e-05 Identity = 25/63 (39.68%), Postives = 38/63 (60.32%), Query Frame = 0
BLAST of MELO3C022506 vs. ExPASy Swiss-Prot
Match: Q9M7R0 (Calcium-binding allergen Ole e 8 OS=Olea europaea OX=4146 PE=1 SV=1) HSP 1 Score: 47.0 bits (110), Expect = 1.5e-04 Identity = 27/61 (44.26%), Postives = 37/61 (60.66%), Query Frame = 0
BLAST of MELO3C022506 vs. ExPASy Swiss-Prot
Match: P94092 (Polcalcin Cyn d 7 OS=Cynodon dactylon OX=28909 PE=1 SV=2) HSP 1 Score: 47.0 bits (110), Expect = 1.5e-04 Identity = 25/57 (43.86%), Postives = 35/57 (61.40%), Query Frame = 0
BLAST of MELO3C022506 vs. NCBI nr
Match: XP_008460131.1 (PREDICTED: calmodulin-like protein 7 [Cucumis melo]) HSP 1 Score: 199.5 bits (506), Expect = 1.4e-47 Identity = 101/101 (100.00%), Postives = 101/101 (100.00%), Query Frame = 0
BLAST of MELO3C022506 vs. NCBI nr
Match: KAA0040005.1 (calmodulin-like protein 7 [Cucumis melo var. makuwa]) HSP 1 Score: 191.0 bits (484), Expect = 4.8e-45 Identity = 97/101 (96.04%), Postives = 98/101 (97.03%), Query Frame = 0
BLAST of MELO3C022506 vs. NCBI nr
Match: XP_004153117.1 (calmodulin-beta [Cucumis sativus] >KGN46235.1 hypothetical protein Csa_005220 [Cucumis sativus]) HSP 1 Score: 191.0 bits (484), Expect = 4.8e-45 Identity = 96/101 (95.05%), Postives = 98/101 (97.03%), Query Frame = 0
BLAST of MELO3C022506 vs. NCBI nr
Match: XP_010092847.1 (probable calcium-binding protein CML23 [Morus notabilis] >EXB52665.1 putative calcium-binding protein CML25 [Morus notabilis]) HSP 1 Score: 75.5 bits (184), Expect = 3.0e-10 Identity = 36/63 (57.14%), Postives = 47/63 (74.60%), Query Frame = 0
BLAST of MELO3C022506 vs. NCBI nr
Match: PON42182.1 (Parvalbumin [Trema orientale]) HSP 1 Score: 75.5 bits (184), Expect = 3.0e-10 Identity = 36/63 (57.14%), Postives = 46/63 (73.02%), Query Frame = 0
BLAST of MELO3C022506 vs. ExPASy TrEMBL
Match: A0A1S3CBX8 (calmodulin-like protein 7 OS=Cucumis melo OX=3656 GN=LOC103499032 PE=4 SV=1) HSP 1 Score: 199.5 bits (506), Expect = 6.6e-48 Identity = 101/101 (100.00%), Postives = 101/101 (100.00%), Query Frame = 0
BLAST of MELO3C022506 vs. ExPASy TrEMBL
Match: A0A5A7TEW8 (Calmodulin-like protein 7 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold122G002880 PE=4 SV=1) HSP 1 Score: 191.0 bits (484), Expect = 2.3e-45 Identity = 97/101 (96.04%), Postives = 98/101 (97.03%), Query Frame = 0
BLAST of MELO3C022506 vs. ExPASy TrEMBL
Match: A0A0A0K8Z4 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G076830 PE=4 SV=1) HSP 1 Score: 191.0 bits (484), Expect = 2.3e-45 Identity = 96/101 (95.05%), Postives = 98/101 (97.03%), Query Frame = 0
BLAST of MELO3C022506 vs. ExPASy TrEMBL
Match: W9QZX9 (Putative calcium-binding protein CML25 OS=Morus notabilis OX=981085 GN=L484_022442 PE=4 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 1.4e-10 Identity = 36/63 (57.14%), Postives = 47/63 (74.60%), Query Frame = 0
BLAST of MELO3C022506 vs. ExPASy TrEMBL
Match: A0A2P5B057 (Parvalbumin OS=Trema orientale OX=63057 GN=TorRG33x02_336390 PE=4 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 1.4e-10 Identity = 36/63 (57.14%), Postives = 46/63 (73.02%), Query Frame = 0
BLAST of MELO3C022506 vs. TAIR 10
Match: AT5G42380.1 (calmodulin like 37 ) HSP 1 Score: 48.1 bits (113), Expect = 4.7e-06 Identity = 28/77 (36.36%), Postives = 44/77 (57.14%), Query Frame = 0
BLAST of MELO3C022506 vs. TAIR 10
Match: AT1G21550.1 (Calcium-binding EF-hand family protein ) HSP 1 Score: 46.6 bits (109), Expect = 1.4e-05 Identity = 21/55 (38.18%), Postives = 33/55 (60.00%), Query Frame = 0
BLAST of MELO3C022506 vs. TAIR 10
Match: AT1G24620.1 (EF hand calcium-binding protein family ) HSP 1 Score: 45.8 bits (107), Expect = 2.3e-05 Identity = 27/81 (33.33%), Postives = 44/81 (54.32%), Query Frame = 0
BLAST of MELO3C022506 vs. TAIR 10
Match: AT3G59440.1 (Calcium-binding EF-hand family protein ) HSP 1 Score: 45.4 bits (106), Expect = 3.1e-05 Identity = 22/57 (38.60%), Postives = 34/57 (59.65%), Query Frame = 0
BLAST of MELO3C022506 vs. TAIR 10
Match: AT5G17470.1 (EF hand calcium-binding protein family ) HSP 1 Score: 45.1 bits (105), Expect = 4.0e-05 Identity = 25/55 (45.45%), Postives = 34/55 (61.82%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|