
MELO3C020729 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTGATACAAAGTCTACAATAGCTAAAGATGTTACTGAAGTGAGCCACTGACCTTCCTCCCTCTCTTTTTCCTCAATTGAATTTCAAGGATTGTCTTAGCTTATTATTAAGAACTTTTGAATTTCCTTACATCCATTTTTCATATATTAAAATTTTCAGCTAATTGGGAATACACCACTTGTATATCTCAACCGTGTTGTTGATGGCTGCGTGGCTCGGGTAGCTGCCAAGTTGGAGATGATGGAGCCTTGCTCTAGTGTCAAAGATAGGTACTTTTTATTTTTAATTATAGTTTTTTT ATGGTTGATACAAAGTCTACAATAGCTAAAGATGTTACTGAACTAATTGGGAATACACCACTTGTATATCTCAACCGTGTTGTTGATGGCTGCGTGGCTCGGGTAGCTGCCAAGTTGGAGATGATGGAGCCTTGCTCTAGTGTCAAAGATAGGTACTTTTTATTTTTAATTATAGTTTTTTT ATGGTTGATACAAAGTCTACAATAGCTAAAGATGTTACTGAACTAATTGGGAATACACCACTTGTATATCTCAACCGTGTTGTTGATGGCTGCGTGGCTCGGGTAGCTGCCAAGTTGGAGATGATGGAGCCTTGCTCTAGTGTCAAAGATAGGTACTTTTTATTTTTAATTATAGTTTTT MVDTKSTIAKDVTELIGNTPLVYLNRVVDGCVARVAAKLEMMEPCSSVKDRYFLFLIIVF Homology
BLAST of MELO3C020729 vs. NCBI nr
Match: XP_008455731.1 (PREDICTED: cysteine synthase isoform X2 [Cucumis melo] >XP_008455734.1 PREDICTED: cysteine synthase isoform X2 [Cucumis melo] >ADN33908.1 cysteine synthase [Cucumis melo subsp. melo]) HSP 1 Score: 103.6 bits (257), Expect = 6.0e-19 Identity = 51/51 (100.00%), Postives = 51/51 (100.00%), Query Frame = 0
BLAST of MELO3C020729 vs. NCBI nr
Match: XP_008455725.2 (PREDICTED: cysteine synthase isoform X1 [Cucumis melo]) HSP 1 Score: 103.6 bits (257), Expect = 6.0e-19 Identity = 51/51 (100.00%), Postives = 51/51 (100.00%), Query Frame = 0
BLAST of MELO3C020729 vs. NCBI nr
Match: XP_038890826.1 (cysteine synthase [Benincasa hispida] >XP_038890827.1 cysteine synthase [Benincasa hispida] >XP_038890828.1 cysteine synthase [Benincasa hispida]) HSP 1 Score: 101.7 bits (252), Expect = 2.3e-18 Identity = 50/51 (98.04%), Postives = 50/51 (98.04%), Query Frame = 0
BLAST of MELO3C020729 vs. NCBI nr
Match: Q43317.1 (RecName: Full=Cysteine synthase; Short=CSase; AltName: Full=Beta-PA/CSase; AltName: Full=Beta-pyrazolylalanine synthase; AltName: Full=L-mimosine synthase; AltName: Full=O-acetylserine (thiol)-lyase; Short=OAS-TL; AltName: Full=O-acetylserine sulfhydrylase [Citrullus lanatus] >BAA05965.1 cysteine synthase [Citrullus lanatus subsp. vulgaris]) HSP 1 Score: 100.1 bits (248), Expect = 6.7e-18 Identity = 49/51 (96.08%), Postives = 49/51 (96.08%), Query Frame = 0
BLAST of MELO3C020729 vs. NCBI nr
Match: KAG6586292.1 (hypothetical protein SDJN03_19025, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 97.8 bits (242), Expect = 3.3e-17 Identity = 48/51 (94.12%), Postives = 49/51 (96.08%), Query Frame = 0
BLAST of MELO3C020729 vs. ExPASy Swiss-Prot
Match: Q43317 (Cysteine synthase OS=Citrullus lanatus OX=3654 PE=1 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 8.8e-21 Identity = 49/51 (96.08%), Postives = 49/51 (96.08%), Query Frame = 0
BLAST of MELO3C020729 vs. ExPASy Swiss-Prot
Match: O81154 (Cysteine synthase OS=Solanum tuberosum OX=4113 PE=2 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 4.5e-17 Identity = 44/51 (86.27%), Postives = 44/51 (86.27%), Query Frame = 0
BLAST of MELO3C020729 vs. ExPASy Swiss-Prot
Match: Q9XEA6 (Cysteine synthase OS=Oryza sativa subsp. japonica OX=39947 GN=RCS1 PE=2 SV=2) HSP 1 Score: 87.0 bits (214), Expect = 7.7e-17 Identity = 42/45 (93.33%), Postives = 42/45 (93.33%), Query Frame = 0
BLAST of MELO3C020729 vs. ExPASy Swiss-Prot
Match: Q00834 (Cysteine synthase OS=Spinacia oleracea OX=3562 PE=1 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 1.0e-16 Identity = 43/51 (84.31%), Postives = 45/51 (88.24%), Query Frame = 0
BLAST of MELO3C020729 vs. ExPASy Swiss-Prot
Match: P47998 (Cysteine synthase 1 OS=Arabidopsis thaliana OX=3702 GN=OASA1 PE=1 SV=2) HSP 1 Score: 85.1 bits (209), Expect = 2.9e-16 Identity = 41/46 (89.13%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of MELO3C020729 vs. ExPASy TrEMBL
Match: A0A1S3C157 (Cysteine synthase OS=Cucumis melo OX=3656 GN=LOC103495826 PE=3 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 2.9e-19 Identity = 51/51 (100.00%), Postives = 51/51 (100.00%), Query Frame = 0
BLAST of MELO3C020729 vs. ExPASy TrEMBL
Match: E5GBR6 (Cysteine synthase OS=Cucumis melo subsp. melo OX=412675 PE=3 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 2.9e-19 Identity = 51/51 (100.00%), Postives = 51/51 (100.00%), Query Frame = 0
BLAST of MELO3C020729 vs. ExPASy TrEMBL
Match: A0A1S3C1N8 (Cysteine synthase OS=Cucumis melo OX=3656 GN=LOC103495826 PE=3 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 2.9e-19 Identity = 51/51 (100.00%), Postives = 51/51 (100.00%), Query Frame = 0
BLAST of MELO3C020729 vs. ExPASy TrEMBL
Match: A0A6J1HPW0 (Cysteine synthase OS=Cucurbita maxima OX=3661 GN=LOC111465603 PE=3 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 1.6e-17 Identity = 48/51 (94.12%), Postives = 49/51 (96.08%), Query Frame = 0
BLAST of MELO3C020729 vs. ExPASy TrEMBL
Match: A0A6J1FB21 (Cysteine synthase OS=Cucurbita moschata OX=3662 GN=LOC111444010 PE=3 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 1.6e-17 Identity = 48/51 (94.12%), Postives = 49/51 (96.08%), Query Frame = 0
BLAST of MELO3C020729 vs. TAIR 10
Match: AT4G14880.1 (O-acetylserine (thiol) lyase (OAS-TL) isoform A1 ) HSP 1 Score: 85.1 bits (209), Expect = 2.1e-17 Identity = 41/46 (89.13%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of MELO3C020729 vs. TAIR 10
Match: AT4G14880.2 (O-acetylserine (thiol) lyase (OAS-TL) isoform A1 ) HSP 1 Score: 85.1 bits (209), Expect = 2.1e-17 Identity = 41/46 (89.13%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of MELO3C020729 vs. TAIR 10
Match: AT4G14880.3 (O-acetylserine (thiol) lyase (OAS-TL) isoform A1 ) HSP 1 Score: 85.1 bits (209), Expect = 2.1e-17 Identity = 41/46 (89.13%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of MELO3C020729 vs. TAIR 10
Match: AT4G14880.4 (O-acetylserine (thiol) lyase (OAS-TL) isoform A1 ) HSP 1 Score: 85.1 bits (209), Expect = 2.1e-17 Identity = 41/46 (89.13%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of MELO3C020729 vs. TAIR 10
Match: AT5G28020.1 (cysteine synthase D2 ) HSP 1 Score: 84.0 bits (206), Expect = 4.6e-17 Identity = 38/50 (76.00%), Postives = 44/50 (88.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
|