MELO3C019477.jh1 (gene) Melon (Harukei-3) v1.41
Overview
Sequences
The following sequences are available for this feature:
Legend: exonstart_codonCDSpolypeptidestop_codon Hold the cursor over a type above to highlight its positions in the sequence below.ATGATCAAGAGATTCGTGAAGTGGCTGATTCTACATAGTACATGCATCCCCGATAGCTGCATCGTAAACATATATGATGAAGGAGATTGCATTCCTCCACACATTGATCACCATGATTTTCTAAGACCCTTTTGCACTGTGTCATTTCAAACAGAAAGTAACATCATATTTGGCACTCGACTAGAAGTTCTTAGTCCTAGAGAGTTCTCTGGTCCTGTCTCGACTCCTTTGCTCTAA ATGATCAAGAGATTCGTGAAGTGGCTGATTCTACATAGTACATGCATCCCCGATAGCTGCATCGTAAACATATATGATGAAGGAGATTGCATTCCTCCACACATTGATCACCATGATTTTCTAAGACCCTTTTGCACTGTGTCATTTCAAACAGAAAGTAACATCATATTTGGCACTCGACTAGAAGTTCTTAGTCCTAGAGAGTTCTCTGGTCCTGTCTCGACTCCTTTGCTCTAA ATGATCAAGAGATTCGTGAAGTGGCTGATTCTACATAGTACATGCATCCCCGATAGCTGCATCGTAAACATATATGATGAAGGAGATTGCATTCCTCCACACATTGATCACCATGATTTTCTAAGACCCTTTTGCACTGTGTCATTTCAAACAGAAAGTAACATCATATTTGGCACTCGACTAGAAGTTCTTAGTCCTAGAGAGTTCTCTGGTCCTGTCTCGACTCCTTTGCTCTAA MIKRFVKWLILHSTCIPDSCIVNIYDEGDCIPPHIDHHDFLRPFCTVSFQTESNIIFGTRLEVLSPREFSGPVSTPLL Homology
BLAST of MELO3C019477.jh1 vs. NCBI nr
Match: XP_022149186.1 (RNA demethylase ALKBH5-like [Momordica charantia]) HSP 1 Score: 148 bits (374), Expect = 4.94e-40 Identity = 66/77 (85.71%), Postives = 70/77 (90.91%), Query Frame = 0
BLAST of MELO3C019477.jh1 vs. NCBI nr
Match: KAF2293798.1 (hypothetical protein GH714_004819 [Hevea brasiliensis]) HSP 1 Score: 142 bits (358), Expect = 1.04e-38 Identity = 62/77 (80.52%), Postives = 68/77 (88.31%), Query Frame = 0
BLAST of MELO3C019477.jh1 vs. NCBI nr
Match: XP_021672522.1 (uncharacterized protein LOC110659008 [Hevea brasiliensis]) HSP 1 Score: 142 bits (358), Expect = 4.71e-38 Identity = 62/77 (80.52%), Postives = 68/77 (88.31%), Query Frame = 0
BLAST of MELO3C019477.jh1 vs. NCBI nr
Match: KDO40724.1 (hypothetical protein CISIN_1g025324mg [Citrus sinensis]) HSP 1 Score: 137 bits (344), Expect = 5.02e-38 Identity = 59/77 (76.62%), Postives = 67/77 (87.01%), Query Frame = 0
BLAST of MELO3C019477.jh1 vs. NCBI nr
Match: XP_021617215.1 (uncharacterized protein LOC110618397 isoform X2 [Manihot esculenta] >KAG8650240.1 hypothetical protein MANES_07G016100v8 [Manihot esculenta]) HSP 1 Score: 141 bits (355), Expect = 8.51e-38 Identity = 61/77 (79.22%), Postives = 69/77 (89.61%), Query Frame = 0
BLAST of MELO3C019477.jh1 vs. ExPASy Swiss-Prot
Match: Q9SL49 (RNA demethylase ALKBH9B OS=Arabidopsis thaliana OX=3702 GN=ALKBH9B PE=1 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 4.8e-27 Identity = 50/77 (64.94%), Postives = 64/77 (83.12%), Query Frame = 0
BLAST of MELO3C019477.jh1 vs. ExPASy TrEMBL
Match: A0A6J1D7M0 (RNA demethylase ALKBH5-like OS=Momordica charantia OX=3673 GN=LOC111017672 PE=4 SV=1) HSP 1 Score: 148 bits (374), Expect = 2.39e-40 Identity = 66/77 (85.71%), Postives = 70/77 (90.91%), Query Frame = 0
BLAST of MELO3C019477.jh1 vs. ExPASy TrEMBL
Match: A0A6A6L0P8 (Fe2OG dioxygenase domain-containing protein OS=Hevea brasiliensis OX=3981 GN=GH714_004819 PE=4 SV=1) HSP 1 Score: 142 bits (358), Expect = 5.01e-39 Identity = 62/77 (80.52%), Postives = 68/77 (88.31%), Query Frame = 0
BLAST of MELO3C019477.jh1 vs. ExPASy TrEMBL
Match: A0A067DCM5 (Fe2OG dioxygenase domain-containing protein OS=Citrus sinensis OX=2711 GN=CISIN_1g025324mg PE=4 SV=1) HSP 1 Score: 137 bits (344), Expect = 2.43e-38 Identity = 59/77 (76.62%), Postives = 67/77 (87.01%), Query Frame = 0
BLAST of MELO3C019477.jh1 vs. ExPASy TrEMBL
Match: A0A7J6V147 (Rna demethylase alkbh9b OS=Thalictrum thalictroides OX=46969 GN=FRX31_031707 PE=4 SV=1) HSP 1 Score: 136 bits (342), Expect = 4.62e-38 Identity = 59/77 (76.62%), Postives = 68/77 (88.31%), Query Frame = 0
BLAST of MELO3C019477.jh1 vs. ExPASy TrEMBL
Match: A0A2C9VHM6 (Fe2OG dioxygenase domain-containing protein OS=Manihot esculenta OX=3983 GN=MANES_07G016100 PE=4 SV=1) HSP 1 Score: 141 bits (355), Expect = 5.81e-38 Identity = 61/77 (79.22%), Postives = 69/77 (89.61%), Query Frame = 0
BLAST of MELO3C019477.jh1 vs. TAIR 10
Match: AT4G36090.1 (oxidoreductase, 2OG-Fe(II) oxygenase family protein ) HSP 1 Score: 123.2 bits (308), Expect = 8.9e-29 Identity = 54/77 (70.13%), Postives = 63/77 (81.82%), Query Frame = 0
BLAST of MELO3C019477.jh1 vs. TAIR 10
Match: AT4G36090.2 (oxidoreductase, 2OG-Fe(II) oxygenase family protein ) HSP 1 Score: 123.2 bits (308), Expect = 8.9e-29 Identity = 54/77 (70.13%), Postives = 63/77 (81.82%), Query Frame = 0
BLAST of MELO3C019477.jh1 vs. TAIR 10
Match: AT4G36090.3 (oxidoreductase, 2OG-Fe(II) oxygenase family protein ) HSP 1 Score: 123.2 bits (308), Expect = 8.9e-29 Identity = 54/77 (70.13%), Postives = 63/77 (81.82%), Query Frame = 0
BLAST of MELO3C019477.jh1 vs. TAIR 10
Match: AT2G17970.1 (2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein ) HSP 1 Score: 121.3 bits (303), Expect = 3.4e-28 Identity = 50/77 (64.94%), Postives = 64/77 (83.12%), Query Frame = 0
BLAST of MELO3C019477.jh1 vs. TAIR 10
Match: AT2G17970.2 (2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein ) HSP 1 Score: 121.3 bits (303), Expect = 3.4e-28 Identity = 50/77 (64.94%), Postives = 64/77 (83.12%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Harukei-3) v1.41
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|