MELO3C011893 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAACTAAAGCTTATGTTCCTCAAGGTGTTTGGAAAAGAGATTGACAAACAAGGATGTGTTAGAAGCCTGTGCTTTGAATCAGGATATCAAGTTGTGGCCGGATGGAGATTGTTCTTTGTTGGGAGAGACGGAGATGAACTTAAGTGGAGGGCAAAAGCAGAGGATTCAATTGGCAAGGGCTGTCTATAGTGATGCAGATGTTTACTTCTTGGATGATCCTTTTAGTGTTGTGGATGCATATACTGAAACACATTTGTTCAACGTAAGCATCATCTTGCTATTGTTCTTCTTGTCTGTTTCCTTTTATGATCTTTTACTTCTTCACTGA ATGGAACTAAAGCTTATGTTCCTCAAGGATATCAAGTTGTGGCCGGATGGAGATTGTTCTTTGTTGGGAGAGACGGAGATGAACTTAAGTGGAGGGCAAAAGCAGAGGATTCAATTGGCAAGGGCTGTCTATAGTGATGCAGATGTTTACTTCTTGGATGATCCTTTTAGTGTTGTGGATGCATATACTGAAACACATTTGTTCAACGTAAGCATCATCTTGCTATTGTTCTTCTTGTCTGTTTCCTTTTATGATCTTTTACTTCTTCACTGA ATGGAACTAAAGCTTATGTTCCTCAAGGATATCAAGTTGTGGCCGGATGGAGATTGTTCTTTGTTGGGAGAGACGGAGATGAACTTAAGTGGAGGGCAAAAGCAGAGGATTCAATTGGCAAGGGCTGTCTATAGTGATGCAGATGTTTACTTCTTGGATGATCCTTTTAGTGTTGTGGATGCATATACTGAAACACATTTGTTCAACGTAAGCATCATCTTGCTATTGTTCTTCTTGTCTGTTTCCTTTTATGATCTTTTACTTCTTCACTGA MELKLMFLKDIKLWPDGDCSLLGETEMNLSGGQKQRIQLARAVYSDADVYFLDDPFSVVDAYTETHLFNVSIILLLFFLSVSFYDLLLLH Homology
BLAST of MELO3C011893 vs. NCBI nr
Match: KAA0034219.1 (putative ABC transporter C family member 15 [Cucumis melo var. makuwa] >TYK15701.1 putative ABC transporter C family member 15 [Cucumis melo var. makuwa]) HSP 1 Score: 110.9 bits (276), Expect = 5.7e-21 Identity = 55/68 (80.88%), Postives = 58/68 (85.29%), Query Frame = 0
BLAST of MELO3C011893 vs. NCBI nr
Match: XP_008446087.1 (PREDICTED: putative ABC transporter C family member 15 [Cucumis melo]) HSP 1 Score: 110.9 bits (276), Expect = 5.7e-21 Identity = 55/68 (80.88%), Postives = 58/68 (85.29%), Query Frame = 0
BLAST of MELO3C011893 vs. NCBI nr
Match: XP_004135511.2 (putative ABC transporter C family member 15 [Cucumis sativus] >KGN51699.1 hypothetical protein Csa_008391 [Cucumis sativus]) HSP 1 Score: 110.9 bits (276), Expect = 5.7e-21 Identity = 55/68 (80.88%), Postives = 58/68 (85.29%), Query Frame = 0
BLAST of MELO3C011893 vs. NCBI nr
Match: XP_038892249.1 (putative ABC transporter C family member 15 [Benincasa hispida]) HSP 1 Score: 110.5 bits (275), Expect = 7.4e-21 Identity = 54/68 (79.41%), Postives = 58/68 (85.29%), Query Frame = 0
BLAST of MELO3C011893 vs. NCBI nr
Match: XP_023512574.1 (putative ABC transporter C family member 15 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 109.0 bits (271), Expect = 2.2e-20 Identity = 53/68 (77.94%), Postives = 58/68 (85.29%), Query Frame = 0
BLAST of MELO3C011893 vs. ExPASy Swiss-Prot
Match: Q9LYS2 (ABC transporter C family member 10 OS=Arabidopsis thaliana OX=3702 GN=ABCC10 PE=2 SV=2) HSP 1 Score: 88.6 bits (218), Expect = 4.0e-17 Identity = 41/60 (68.33%), Postives = 50/60 (83.33%), Query Frame = 0
BLAST of MELO3C011893 vs. ExPASy Swiss-Prot
Match: Q9LK62 (ABC transporter C family member 7 OS=Arabidopsis thaliana OX=3702 GN=ABCC7 PE=1 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 5.7e-16 Identity = 39/68 (57.35%), Postives = 54/68 (79.41%), Query Frame = 0
BLAST of MELO3C011893 vs. ExPASy Swiss-Prot
Match: Q54JR2 (ABC transporter C family member 3 OS=Dictyostelium discoideum OX=44689 GN=abcC3 PE=3 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 7.5e-16 Identity = 38/61 (62.30%), Postives = 48/61 (78.69%), Query Frame = 0
BLAST of MELO3C011893 vs. ExPASy Swiss-Prot
Match: Q8ST87 (ABC transporter C family member 10 OS=Dictyostelium discoideum OX=44689 GN=abcC10 PE=3 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 7.5e-16 Identity = 38/61 (62.30%), Postives = 48/61 (78.69%), Query Frame = 0
BLAST of MELO3C011893 vs. ExPASy Swiss-Prot
Match: Q54U44 (ABC transporter C family member 12 OS=Dictyostelium discoideum OX=44689 GN=abcC12 PE=3 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 7.5e-16 Identity = 38/61 (62.30%), Postives = 48/61 (78.69%), Query Frame = 0
BLAST of MELO3C011893 vs. ExPASy TrEMBL
Match: A0A5D3CUX0 (Putative ABC transporter C family member 15 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold35G002000 PE=4 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 2.8e-21 Identity = 55/68 (80.88%), Postives = 58/68 (85.29%), Query Frame = 0
BLAST of MELO3C011893 vs. ExPASy TrEMBL
Match: A0A0A0KS22 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G590160 PE=4 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 2.8e-21 Identity = 55/68 (80.88%), Postives = 58/68 (85.29%), Query Frame = 0
BLAST of MELO3C011893 vs. ExPASy TrEMBL
Match: A0A1S3BF27 (putative ABC transporter C family member 15 OS=Cucumis melo OX=3656 GN=LOC103488915 PE=4 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 2.8e-21 Identity = 55/68 (80.88%), Postives = 58/68 (85.29%), Query Frame = 0
BLAST of MELO3C011893 vs. ExPASy TrEMBL
Match: A0A6J1FZE2 (putative ABC transporter C family member 15 OS=Cucurbita moschata OX=3662 GN=LOC111449319 PE=4 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 1.4e-20 Identity = 53/68 (77.94%), Postives = 58/68 (85.29%), Query Frame = 0
BLAST of MELO3C011893 vs. ExPASy TrEMBL
Match: A0A6J1HUS2 (putative ABC transporter C family member 15 OS=Cucurbita maxima OX=3661 GN=LOC111466379 PE=4 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 1.8e-20 Identity = 52/68 (76.47%), Postives = 58/68 (85.29%), Query Frame = 0
BLAST of MELO3C011893 vs. TAIR 10
Match: AT3G59140.1 (multidrug resistance-associated protein 14 ) HSP 1 Score: 88.6 bits (218), Expect = 2.8e-18 Identity = 41/60 (68.33%), Postives = 50/60 (83.33%), Query Frame = 0
BLAST of MELO3C011893 vs. TAIR 10
Match: AT3G13100.1 (multidrug resistance-associated protein 7 ) HSP 1 Score: 84.7 bits (208), Expect = 4.1e-17 Identity = 39/68 (57.35%), Postives = 54/68 (79.41%), Query Frame = 0
BLAST of MELO3C011893 vs. TAIR 10
Match: AT3G13090.1 (multidrug resistance-associated protein 8 ) HSP 1 Score: 84.0 bits (206), Expect = 6.9e-17 Identity = 39/68 (57.35%), Postives = 53/68 (77.94%), Query Frame = 0
BLAST of MELO3C011893 vs. TAIR 10
Match: AT1G04120.1 (multidrug resistance-associated protein 5 ) HSP 1 Score: 83.2 bits (204), Expect = 1.2e-16 Identity = 42/75 (56.00%), Postives = 56/75 (74.67%), Query Frame = 0
BLAST of MELO3C011893 vs. TAIR 10
Match: AT1G04120.2 (multidrug resistance-associated protein 5 ) HSP 1 Score: 83.2 bits (204), Expect = 1.2e-16 Identity = 42/75 (56.00%), Postives = 56/75 (74.67%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|