MELO3C005268 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAAAGGAATCAAAGGGCTCTTGTGTAAGAGAGTTCATCAGGAAAAAAGTCCCAAACTGGGATGACGAAGTGGTGGCTACAGCTCGGTTTAAGGCATTTAGTAGGCAGAAATCTTATTGGGAACCCAAGTACTTATTTTGGAGGGATTTGATACTCATAGTTGCCCATCAATTCAAATTCCTTATTATAAAACCTGATGAAATAAAGAATCAATGA ATGGAAAAGGAATCAAAGGGCTCTTGTGTAAGAGAGTTCATCAGGAAAAAAGTCCCAAACTGGGATGACGAAGTGGTGGCTACAGCTCGGTTTAAGGCATTTAGTAGGCAGAAATCTTATTGGGAACCCAAGTACTTATTTTGGAGGGATTTGATACTCATAGTTGCCCATCAATTCAAATTCCTTATTATAAAACCTGATGAAATAAAGAATCAATGA ATGGAAAAGGAATCAAAGGGCTCTTGTGTAAGAGAGTTCATCAGGAAAAAAGTCCCAAACTGGGATGACGAAGTGGTGGCTACAGCTCGGTTTAAGGCATTTAGTAGGCAGAAATCTTATTGGGAACCCAAGTACTTATTTTGGAGGGATTTGATACTCATAGTTGCCCATCAATTCAAATTCCTTATTATAAAACCTGATGAAATAAAGAATCAATGA MEKESKGSCVREFIRKKVPNWDDEVVATARFKAFSRQKSYWEPKYLFWRDLILIVAHQFKFLIIKPDEIKNQ Homology
BLAST of MELO3C005268 vs. NCBI nr
Match: KGN50975.2 (hypothetical protein Csa_017819 [Cucumis sativus]) HSP 1 Score: 132.9 bits (333), Expect = 1.1e-27 Identity = 63/72 (87.50%), Postives = 66/72 (91.67%), Query Frame = 0
BLAST of MELO3C005268 vs. NCBI nr
Match: XP_011654554.1 (charged multivesicular body protein 7 [Cucumis sativus] >XP_031742319.1 charged multivesicular body protein 7 [Cucumis sativus] >XP_031742320.1 charged multivesicular body protein 7 [Cucumis sativus] >XP_031742321.1 charged multivesicular body protein 7 [Cucumis sativus] >XP_031742322.1 charged multivesicular body protein 7 [Cucumis sativus] >XP_031742323.1 charged multivesicular body protein 7 [Cucumis sativus] >XP_031742324.1 charged multivesicular body protein 7 [Cucumis sativus] >XP_031742325.1 charged multivesicular body protein 7 [Cucumis sativus] >XP_031742326.1 charged multivesicular body protein 7 [Cucumis sativus]) HSP 1 Score: 132.9 bits (333), Expect = 1.1e-27 Identity = 63/72 (87.50%), Postives = 66/72 (91.67%), Query Frame = 0
BLAST of MELO3C005268 vs. NCBI nr
Match: KAA0050281.1 (charged multivesicular body protein 7 isoform X2 [Cucumis melo var. makuwa] >TYJ98126.1 charged multivesicular body protein 7 isoform X2 [Cucumis melo var. makuwa]) HSP 1 Score: 126.7 bits (317), Expect = 8.0e-26 Identity = 61/72 (84.72%), Postives = 64/72 (88.89%), Query Frame = 0
BLAST of MELO3C005268 vs. NCBI nr
Match: XP_008466468.1 (PREDICTED: charged multivesicular body protein 7 isoform X2 [Cucumis melo]) HSP 1 Score: 126.7 bits (317), Expect = 8.0e-26 Identity = 61/72 (84.72%), Postives = 64/72 (88.89%), Query Frame = 0
BLAST of MELO3C005268 vs. NCBI nr
Match: XP_008466425.1 (PREDICTED: charged multivesicular body protein 7 isoform X1 [Cucumis melo] >XP_008466434.1 PREDICTED: charged multivesicular body protein 7 isoform X1 [Cucumis melo] >XP_008466443.1 PREDICTED: charged multivesicular body protein 7 isoform X1 [Cucumis melo] >XP_008466452.1 PREDICTED: charged multivesicular body protein 7 isoform X1 [Cucumis melo] >XP_008466460.1 PREDICTED: charged multivesicular body protein 7 isoform X1 [Cucumis melo]) HSP 1 Score: 126.7 bits (317), Expect = 8.0e-26 Identity = 61/72 (84.72%), Postives = 64/72 (88.89%), Query Frame = 0
BLAST of MELO3C005268 vs. ExPASy TrEMBL
Match: A0A0A0KMY2 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G118690 PE=4 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 5.4e-28 Identity = 63/72 (87.50%), Postives = 66/72 (91.67%), Query Frame = 0
BLAST of MELO3C005268 vs. ExPASy TrEMBL
Match: A0A1S3CRA4 (charged multivesicular body protein 7 isoform X1 OS=Cucumis melo OX=3656 GN=LOC103503835 PE=4 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 3.9e-26 Identity = 61/72 (84.72%), Postives = 64/72 (88.89%), Query Frame = 0
BLAST of MELO3C005268 vs. ExPASy TrEMBL
Match: A0A5D3BGE9 (Charged multivesicular body protein 7 isoform X2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold180G00010 PE=4 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 3.9e-26 Identity = 61/72 (84.72%), Postives = 64/72 (88.89%), Query Frame = 0
BLAST of MELO3C005268 vs. ExPASy TrEMBL
Match: A0A1S3CRC5 (charged multivesicular body protein 7 isoform X2 OS=Cucumis melo OX=3656 GN=LOC103503835 PE=4 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 3.9e-26 Identity = 61/72 (84.72%), Postives = 64/72 (88.89%), Query Frame = 0
BLAST of MELO3C005268 vs. ExPASy TrEMBL
Match: A0A6J1FF90 (charged multivesicular body protein 7 OS=Cucurbita moschata OX=3662 GN=LOC111444939 PE=4 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 3.6e-24 Identity = 55/72 (76.39%), Postives = 63/72 (87.50%), Query Frame = 0
BLAST of MELO3C005268 vs. TAIR 10
Match: AT3G62080.2 (SNF7 family protein ) HSP 1 Score: 85.5 bits (210), Expect = 1.9e-17 Identity = 40/67 (59.70%), Postives = 50/67 (74.63%), Query Frame = 0
BLAST of MELO3C005268 vs. TAIR 10
Match: AT3G62080.1 (SNF7 family protein ) HSP 1 Score: 85.1 bits (209), Expect = 2.5e-17 Identity = 39/61 (63.93%), Postives = 49/61 (80.33%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
|