MELO3C005021 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ACAAGGGGTTCGATAGGAAAGTCCTTTCGATCCAATCAATTTTTTGAGTCAAATAAAGATAAAGGATATGTTAATGATCTAGCACAAGAAAGCACTCTCCGAGGGCATGAAATGTCTAATTTTTCTTTCAAAGTCATTATAGGAATAGTAATGTCTTTCTTAAATTCTCCGACCGAAATACAAGAGAACTCCATTCAATTCTCGATGGAATCAGAGTTTTTCGAATTTTTCCTAGAACTAACAGATCATTTCAAGATCTTCTCTAAGACTCTAAGGTTCAATGTGACTATTGTCACTTTTGCCAAGACAAAAGATGAGACTTTACCACTGTAA ACAAGGGGTTCGATAGGAAAGTCCTTTCGATCCAATCAATTTTTTGAGTCAAATAAAGATAAAGGATATGTTAATGATCTAGCACAAGAAAGCACTCTCCGAGGGCATGAAATGTCTAATTTTTCTTTCAAAGTCATTATAGGAATAGTAATGTCTTTCTTAAATTCTCCGACCGAAATACAAGAGAACTCCATTCAATTCTCGATGGAATCAGAGTTTTTCGAATTTTTCCTAGAACTAACAGATCATTTCAAGATCTTCTCTAAGACTCTAAGGTTCAATGTGACTATTGTCACTTTTGCCAAGACAAAAGATGAGACTTTACCACTGTAA ACAAGGGGTTCGATAGGAAAGTCCTTTCGATCCAATCAATTTTTTGAGTCAAATAAAGATAAAGGATATGTTAATGATCTAGCACAAGAAAGCACTCTCCGAGGGCATGAAATGTCTAATTTTTCTTTCAAAGTCATTATAGGAATAGTAATGTCTTTCTTAAATTCTCCGACCGAAATACAAGAGAACTCCATTCAATTCTCGATGGAATCAGAGTTTTTCGAATTTTTCCTAGAACTAACAGATCATTTCAAGATCTTCTCTAAGACTCTAAGGTTCAATGTGACTATTGTCACTTTTGCCAAGACAAAAGATGAGACTTTACCACTGTAA TRGSIGKSFRSNQFFESNKDKGYVNDLAQESTLRGHEMSNFSFKVIIGIVMSFLNSPTEIQENSIQFSMESEFFEFFLELTDHFKIFSKTLRFNVTIVTFAKTKDETLPL Homology
BLAST of MELO3C005021 vs. ExPASy Swiss-Prot
Match: P49388 (60S ribosomal protein L5, mitochondrial OS=Brassica napus OX=3708 GN=RPL5 PE=3 SV=2) HSP 1 Score: 134.4 bits (337), Expect = 7.7e-31 Identity = 75/109 (68.81%), Postives = 85/109 (77.98%), Query Frame = 0
BLAST of MELO3C005021 vs. ExPASy Swiss-Prot
Match: Q05492 (60S ribosomal protein L5, mitochondrial OS=Oenothera berteroana OX=3950 GN=RPL5 PE=2 SV=2) HSP 1 Score: 133.3 bits (334), Expect = 1.7e-30 Identity = 74/109 (67.89%), Postives = 85/109 (77.98%), Query Frame = 0
BLAST of MELO3C005021 vs. ExPASy Swiss-Prot
Match: P42793 (60S ribosomal protein L5, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RPL5 PE=1 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 2.5e-29 Identity = 71/109 (65.14%), Postives = 84/109 (77.06%), Query Frame = 0
BLAST of MELO3C005021 vs. ExPASy Swiss-Prot
Match: P51409 (60S ribosomal protein L5, mitochondrial OS=Solanum tuberosum OX=4113 GN=RPL5 PE=2 SV=2) HSP 1 Score: 121.7 bits (304), Expect = 5.2e-27 Identity = 73/110 (66.36%), Postives = 82/110 (74.55%), Query Frame = 0
BLAST of MELO3C005021 vs. ExPASy Swiss-Prot
Match: P26860 (60S ribosomal protein L5, mitochondrial OS=Marchantia polymorpha OX=3197 GN=RPL5 PE=3 SV=2) HSP 1 Score: 93.2 bits (230), Expect = 2.0e-18 Identity = 58/113 (51.33%), Postives = 75/113 (66.37%), Query Frame = 0
BLAST of MELO3C005021 vs. NCBI nr
Match: KAA0034876.1 (ribosomal protein L5 [Cucumis melo var. makuwa]) HSP 1 Score: 181.0 bits (458), Expect = 5.5e-42 Identity = 92/109 (84.40%), Postives = 101/109 (92.66%), Query Frame = 0
BLAST of MELO3C005021 vs. NCBI nr
Match: AEN56134.1 (ribosomal protein L5 [Cucumis melo subsp. melo] >AZP40310.1 ribosomal protein L5 [Cucumis melo var. momordica]) HSP 1 Score: 181.0 bits (458), Expect = 5.5e-42 Identity = 92/109 (84.40%), Postives = 101/109 (92.66%), Query Frame = 0
BLAST of MELO3C005021 vs. NCBI nr
Match: YP_004849341.1 (ribosomal protein L5 [Cucumis sativus] >ADZ10768.1 ribosomal protein L5 [Cucumis sativus]) HSP 1 Score: 166.0 bits (419), Expect = 1.8e-37 Identity = 85/109 (77.98%), Postives = 96/109 (88.07%), Query Frame = 0
BLAST of MELO3C005021 vs. NCBI nr
Match: AAP33159.1 (ribosomal protein L5 [Cucumis sativus] >AAP33161.1 ribosomal protein L5 [Cucumis sativus] >AAP33162.1 ribosomal protein L5 [Cucumis sativus]) HSP 1 Score: 163.3 bits (412), Expect = 1.2e-36 Identity = 85/110 (77.27%), Postives = 96/110 (87.27%), Query Frame = 0
BLAST of MELO3C005021 vs. NCBI nr
Match: AFY03535.1 (ribosomal protein L5, partial [Lagenaria siceraria]) HSP 1 Score: 142.9 bits (359), Expect = 1.6e-30 Identity = 79/108 (73.15%), Postives = 87/108 (80.56%), Query Frame = 0
BLAST of MELO3C005021 vs. ExPASy TrEMBL
Match: A0A5A7SYB1 (Ribosomal protein L5 (Mitochondrion) OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold48303G00010 PE=3 SV=1) HSP 1 Score: 181.0 bits (458), Expect = 2.6e-42 Identity = 92/109 (84.40%), Postives = 101/109 (92.66%), Query Frame = 0
BLAST of MELO3C005021 vs. ExPASy TrEMBL
Match: G3EU44 (Ribosomal protein L5 OS=Cucumis melo subsp. melo OX=412675 GN=rpl5 PE=3 SV=1) HSP 1 Score: 181.0 bits (458), Expect = 2.6e-42 Identity = 92/109 (84.40%), Postives = 101/109 (92.66%), Query Frame = 0
BLAST of MELO3C005021 vs. ExPASy TrEMBL
Match: A0A3S9JIG3 (Ribosomal protein L5 OS=Cucumis melo var. momordica OX=2034244 GN=rpl5 PE=3 SV=1) HSP 1 Score: 181.0 bits (458), Expect = 2.6e-42 Identity = 92/109 (84.40%), Postives = 101/109 (92.66%), Query Frame = 0
BLAST of MELO3C005021 vs. ExPASy TrEMBL
Match: G3EIZ3 (Ribosomal protein L5 OS=Cucumis sativus OX=3659 GN=rpl5 PE=3 SV=1) HSP 1 Score: 166.0 bits (419), Expect = 8.8e-38 Identity = 85/109 (77.98%), Postives = 96/109 (88.07%), Query Frame = 0
BLAST of MELO3C005021 vs. ExPASy TrEMBL
Match: Q7Y6H0 (Ribosomal protein L5 OS=Cucumis sativus OX=3659 GN=rpl5 PE=3 SV=1) HSP 1 Score: 163.3 bits (412), Expect = 5.7e-37 Identity = 85/110 (77.27%), Postives = 96/110 (87.27%), Query Frame = 0
BLAST of MELO3C005021 vs. TAIR 10
Match: AT2G07725.1 (Ribosomal L5P family protein ) HSP 1 Score: 135.2 bits (339), Expect = 3.2e-32 Identity = 75/109 (68.81%), Postives = 85/109 (77.98%), Query Frame = 0
BLAST of MELO3C005021 vs. TAIR 10
Match: ATMG00210.1 (ribosomal protein L5 ) HSP 1 Score: 135.2 bits (339), Expect = 3.2e-32 Identity = 75/109 (68.81%), Postives = 85/109 (77.98%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|