MELO3C004902 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTGAATCAAGATCGGGTTCTAAAACGAGTCTGGCAACACGACTTAAGTTGGACAGTGAGACATCAGATTGTTGGGGAACTTTATACCAACTTCAAGCTTGCACAGGTGAAGTTGTCACATTTTTTCTTACTGGTGAAACTTATTTAGGTTCCAATTGTTGTCAAGCTATTAAAGTCATTCAACATGAGTGCTGGCCAACATTACTCGAGTCTTTAGGATACACGACTGAAGAAGGTGACATTCTTGAAGCCTATTGCAATACCACTATTGATACTCTCAAAACATCATCATCTTCTGATCTATCGTTATCTATTGAGCAAAATACTGCGGCTAAAATCATTGCTCCATGA ATGGTTGAATCAAGATCGGGTTCTAAAACGAGTCTGGCAACACGACTTAAGTTGGACAGTGAGACATCAGATTGTTGGGGAACTTTATACCAACTTCAAGCTTGCACAGGTGAAGTTGTCACATTTTTTCTTACTGGTGAAACTTATTTAGGTTCCAATTGTTGTCAAGCTATTAAAGTCATTCAACATGAGTGCTGGCCAACATTACTCGAGTCTTTAGGATACACGACTGAAGAAGGTGACATTCTTGAAGCCTATTGCAATACCACTATTGATACTCTCAAAACATCATCATCTTCTGATCTATCGTTATCTATTGAGCAAAATACTGCGGCTAAAATCATTGCTCCATGA ATGGTTGAATCAAGATCGGGTTCTAAAACGAGTCTGGCAACACGACTTAAGTTGGACAGTGAGACATCAGATTGTTGGGGAACTTTATACCAACTTCAAGCTTGCACAGGTGAAGTTGTCACATTTTTTCTTACTGGTGAAACTTATTTAGGTTCCAATTGTTGTCAAGCTATTAAAGTCATTCAACATGAGTGCTGGCCAACATTACTCGAGTCTTTAGGATACACGACTGAAGAAGGTGACATTCTTGAAGCCTATTGCAATACCACTATTGATACTCTCAAAACATCATCATCTTCTGATCTATCGTTATCTATTGAGCAAAATACTGCGGCTAAAATCATTGCTCCATGA MVESRSGSKTSLATRLKLDSETSDCWGTLYQLQACTGEVVTFFLTGETYLGSNCCQAIKVIQHECWPTLLESLGYTTEEGDILEAYCNTTIDTLKTSSSSDLSLSIEQNTAAKIIAP Homology
BLAST of MELO3C004902 vs. ExPASy Swiss-Prot
Match: Q9SRD8 (Egg cell-secreted protein 1.1 OS=Arabidopsis thaliana OX=3702 GN=EC1.1 PE=2 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.4e-22 Identity = 52/118 (44.07%), Postives = 71/118 (60.17%), Query Frame = 0
BLAST of MELO3C004902 vs. ExPASy Swiss-Prot
Match: Q9SJ24 (Egg cell-secreted protein 1.2 OS=Arabidopsis thaliana OX=3702 GN=EC1.2 PE=2 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 3.6e-18 Identity = 38/80 (47.50%), Postives = 57/80 (71.25%), Query Frame = 0
BLAST of MELO3C004902 vs. ExPASy Swiss-Prot
Match: Q9T039 (Egg cell-secreted protein 1.4 OS=Arabidopsis thaliana OX=3702 GN=EC1.4 PE=2 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 7.9e-18 Identity = 37/80 (46.25%), Postives = 55/80 (68.75%), Query Frame = 0
BLAST of MELO3C004902 vs. ExPASy Swiss-Prot
Match: Q9SJ23 (Egg cell-secreted protein 1.3 OS=Arabidopsis thaliana OX=3702 GN=EC1.3 PE=2 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 6.7e-17 Identity = 38/80 (47.50%), Postives = 52/80 (65.00%), Query Frame = 0
BLAST of MELO3C004902 vs. NCBI nr
Match: KAA0035199.1 (egg cell-secreted protein 1.2-like [Cucumis melo var. makuwa] >TYK21814.1 egg cell-secreted protein 1.2-like [Cucumis melo var. makuwa]) HSP 1 Score: 235.3 bits (599), Expect = 2.6e-58 Identity = 117/117 (100.00%), Postives = 117/117 (100.00%), Query Frame = 0
BLAST of MELO3C004902 vs. NCBI nr
Match: XP_038895737.1 (egg cell-secreted protein 1.1-like [Benincasa hispida]) HSP 1 Score: 181.4 bits (459), Expect = 4.5e-42 Identity = 88/119 (73.95%), Postives = 101/119 (84.87%), Query Frame = 0
BLAST of MELO3C004902 vs. NCBI nr
Match: XP_038895736.1 (egg cell-secreted protein 1.4-like [Benincasa hispida]) HSP 1 Score: 171.8 bits (434), Expect = 3.5e-39 Identity = 85/120 (70.83%), Postives = 97/120 (80.83%), Query Frame = 0
BLAST of MELO3C004902 vs. NCBI nr
Match: KAE8652773.1 (hypothetical protein Csa_022882 [Cucumis sativus]) HSP 1 Score: 166.0 bits (419), Expect = 1.9e-37 Identity = 87/128 (67.97%), Postives = 93/128 (72.66%), Query Frame = 0
BLAST of MELO3C004902 vs. NCBI nr
Match: XP_022998659.1 (egg cell-secreted protein 1.1-like [Cucurbita maxima]) HSP 1 Score: 164.1 bits (414), Expect = 7.4e-37 Identity = 81/119 (68.07%), Postives = 96/119 (80.67%), Query Frame = 0
BLAST of MELO3C004902 vs. ExPASy TrEMBL
Match: A0A5D3DE13 (Egg cell-secreted protein 1.2-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold991G00290 PE=4 SV=1) HSP 1 Score: 235.3 bits (599), Expect = 1.3e-58 Identity = 117/117 (100.00%), Postives = 117/117 (100.00%), Query Frame = 0
BLAST of MELO3C004902 vs. ExPASy TrEMBL
Match: A0A0A0LVH9 (Prolamin_like domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G124010 PE=4 SV=1) HSP 1 Score: 203.4 bits (516), Expect = 5.3e-49 Identity = 102/117 (87.18%), Postives = 107/117 (91.45%), Query Frame = 0
BLAST of MELO3C004902 vs. ExPASy TrEMBL
Match: A0A6J1KD37 (egg cell-secreted protein 1.1-like OS=Cucurbita maxima OX=3661 GN=LOC111493241 PE=4 SV=1) HSP 1 Score: 164.1 bits (414), Expect = 3.6e-37 Identity = 82/118 (69.49%), Postives = 95/118 (80.51%), Query Frame = 0
BLAST of MELO3C004902 vs. ExPASy TrEMBL
Match: A0A6J1KEX2 (egg cell-secreted protein 1.1-like OS=Cucurbita maxima OX=3661 GN=LOC111493240 PE=4 SV=1) HSP 1 Score: 164.1 bits (414), Expect = 3.6e-37 Identity = 81/119 (68.07%), Postives = 96/119 (80.67%), Query Frame = 0
BLAST of MELO3C004902 vs. ExPASy TrEMBL
Match: A0A0A0LSR4 (Prolamin_like domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G124020 PE=4 SV=1) HSP 1 Score: 159.1 bits (401), Expect = 1.1e-35 Identity = 76/106 (71.70%), Postives = 89/106 (83.96%), Query Frame = 0
BLAST of MELO3C004902 vs. TAIR 10
Match: AT1G76750.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 107.1 bits (266), Expect = 9.9e-24 Identity = 52/118 (44.07%), Postives = 71/118 (60.17%), Query Frame = 0
BLAST of MELO3C004902 vs. TAIR 10
Match: AT2G21740.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 92.4 bits (228), Expect = 2.5e-19 Identity = 38/80 (47.50%), Postives = 57/80 (71.25%), Query Frame = 0
BLAST of MELO3C004902 vs. TAIR 10
Match: AT4G39340.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 91.3 bits (225), Expect = 5.6e-19 Identity = 37/80 (46.25%), Postives = 55/80 (68.75%), Query Frame = 0
BLAST of MELO3C004902 vs. TAIR 10
Match: AT2G21750.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 88.2 bits (217), Expect = 4.8e-18 Identity = 38/80 (47.50%), Postives = 52/80 (65.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|