
MELO3C001168 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGTGCTTTTTTATTACTATCAAAAGGGATTGCTCCGGAGATTCCTGAGGATCTTTACCATTTGATTAAGAAGGTTGTCTCGGTTAGAAAGCATTTGGAAAGGAACAGAAAGGACAAAGACTCCAAGGTACACATTGTACTCT ATGTGTGCTTTTTTATTACTATCAAAAGGGATTGCTCCGGAGATTCCTGAGGATCTTTACCATTTGATTAAGAAGGTTGTCTCGGTTAGAAAGCATTTGGAAAGGAACAGAAAGGACAAAGACTCCAAGGTACACATTGTACTCT ATGTGTGCTTTTTTATTACTATCAAAAGGGATTGCTCCGGAGATTCCTGAGGATCTTTACCATTTGATTAAGAAGGTTGTCTCGGTTAGAAAGCATTTGGAAAGGAACAGAAAGGACAAAGACTCCAAGGTACACATTGTACTC MCAFLLLSKGIAPEIPEDLYHLIKKVVSVRKHLERNRKDKDSKVHIVL Homology
BLAST of MELO3C001168 vs. NCBI nr
Match: KAA0051790.1 (putative ribosomal protein S13 [Cucumis melo var. makuwa]) HSP 1 Score: 86.7 bits (213), Expect = 6.1e-14 Identity = 41/47 (87.23%), Postives = 43/47 (91.49%), Query Frame = 0
BLAST of MELO3C001168 vs. NCBI nr
Match: KAA0025155.1 (uncharacterized protein E6C27_scaffold2405G00020 [Cucumis melo var. makuwa]) HSP 1 Score: 82.8 bits (203), Expect = 8.8e-13 Identity = 39/43 (90.70%), Postives = 41/43 (95.35%), Query Frame = 0
BLAST of MELO3C001168 vs. NCBI nr
Match: VDD87991.1 (unnamed protein product [Enterobius vermicularis]) HSP 1 Score: 76.3 bits (186), Expect = 8.3e-11 Identity = 35/44 (79.55%), Postives = 40/44 (90.91%), Query Frame = 0
BLAST of MELO3C001168 vs. NCBI nr
Match: XP_041527338.1 (40S ribosomal protein S13-like [Microtus oregoni]) HSP 1 Score: 75.9 bits (185), Expect = 1.1e-10 Identity = 33/44 (75.00%), Postives = 41/44 (93.18%), Query Frame = 0
BLAST of MELO3C001168 vs. NCBI nr
Match: MXQ84898.1 (hypothetical protein [Bos mutus]) HSP 1 Score: 75.9 bits (185), Expect = 1.1e-10 Identity = 33/44 (75.00%), Postives = 41/44 (93.18%), Query Frame = 0
BLAST of MELO3C001168 vs. ExPASy Swiss-Prot
Match: P62299 (40S ribosomal protein S13 OS=Brugia pahangi OX=6280 GN=RPS13 PE=2 SV=2) HSP 1 Score: 73.9 bits (180), Expect = 5.4e-13 Identity = 33/44 (75.00%), Postives = 40/44 (90.91%), Query Frame = 0
BLAST of MELO3C001168 vs. ExPASy Swiss-Prot
Match: P62300 (40S ribosomal protein S13 OS=Wuchereria bancrofti OX=6293 GN=RPS13 PE=3 SV=2) HSP 1 Score: 73.9 bits (180), Expect = 5.4e-13 Identity = 33/44 (75.00%), Postives = 40/44 (90.91%), Query Frame = 0
BLAST of MELO3C001168 vs. ExPASy Swiss-Prot
Match: P62302 (40S ribosomal protein S13 OS=Glycine max OX=3847 GN=RPS13 PE=2 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 9.2e-13 Identity = 33/44 (75.00%), Postives = 39/44 (88.64%), Query Frame = 0
BLAST of MELO3C001168 vs. ExPASy Swiss-Prot
Match: Q56JX8 (40S ribosomal protein S13 OS=Bos taurus OX=9913 GN=RPS13 PE=2 SV=3) HSP 1 Score: 72.8 bits (177), Expect = 1.2e-12 Identity = 32/44 (72.73%), Postives = 40/44 (90.91%), Query Frame = 0
BLAST of MELO3C001168 vs. ExPASy Swiss-Prot
Match: Q6ITC7 (40S ribosomal protein S13 OS=Gallus gallus OX=9031 GN=RPS13 PE=2 SV=3) HSP 1 Score: 72.8 bits (177), Expect = 1.2e-12 Identity = 32/44 (72.73%), Postives = 40/44 (90.91%), Query Frame = 0
BLAST of MELO3C001168 vs. ExPASy TrEMBL
Match: A0A5A7U9F0 (Putative ribosomal protein S13 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold60G001980 PE=4 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 3.0e-14 Identity = 41/47 (87.23%), Postives = 43/47 (91.49%), Query Frame = 0
BLAST of MELO3C001168 vs. ExPASy TrEMBL
Match: A0A5A7SL06 (ULP_PROTEASE domain-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold2405G00020 PE=3 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 4.3e-13 Identity = 39/43 (90.70%), Postives = 41/43 (95.35%), Query Frame = 0
BLAST of MELO3C001168 vs. ExPASy TrEMBL
Match: A0A0N4V0I2 (40S ribosomal protein S13 OS=Enterobius vermicularis OX=51028 GN=EVEC_LOCUS3134 PE=3 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 4.0e-11 Identity = 35/44 (79.55%), Postives = 40/44 (90.91%), Query Frame = 0
BLAST of MELO3C001168 vs. ExPASy TrEMBL
Match: A0A0N5AK96 (40S ribosomal protein S13 OS=Syphacia muris OX=451379 PE=3 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 4.0e-11 Identity = 35/44 (79.55%), Postives = 40/44 (90.91%), Query Frame = 0
BLAST of MELO3C001168 vs. ExPASy TrEMBL
Match: A0A6P3IQD5 (40S ribosomal protein S13 OS=Bison bison bison OX=43346 GN=LOC105000012 PE=3 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 5.2e-11 Identity = 33/44 (75.00%), Postives = 41/44 (93.18%), Query Frame = 0
BLAST of MELO3C001168 vs. TAIR 10
Match: AT3G60770.1 (Ribosomal protein S13/S15 ) HSP 1 Score: 72.0 bits (175), Expect = 1.5e-13 Identity = 32/44 (72.73%), Postives = 39/44 (88.64%), Query Frame = 0
BLAST of MELO3C001168 vs. TAIR 10
Match: AT4G00100.1 (ribosomal protein S13A ) HSP 1 Score: 72.0 bits (175), Expect = 1.5e-13 Identity = 32/44 (72.73%), Postives = 39/44 (88.64%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06
Relationships
The following mRNA feature(s) are a part of this gene:
|