
MC11g1422 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TTTTTCCAAGGTTTTTTCGTACCGGCTTCTTCTACCTTTACTGCAATGGAAGCATCTAAAGGTGAATTTGATGTCTTTCTGGTTAGTAATAGAAGTAATCGTCCCTAC TTTTTCCAAGGTTTTTTCGTACCGGCTTCTTCTACCTTTACTGCAATGGAAGCATCTAAAGGTGAATTTGATGTCTTTCTGGTTAGTAATAGAAGTAATCGTCCCTAC TTTTTCCAAGGTTTTTTCGTACCGGCTTCTTCTACCTTTACTGCAATGGAAGCATCTAAAGGTGAATTTGATGTCTTTCTGGTTAGTAATAGAAGTAATCGTCCCTAC FFQGFFVPASSTFTAMEASKGEFDVFLVSNRSNRPY Homology
BLAST of MC11g1422 vs. ExPASy Swiss-Prot
Match: P93306 (NADH dehydrogenase [ubiquinone] iron-sulfur protein 2 OS=Arabidopsis thaliana OX=3702 GN=NAD7 PE=1 SV=2) HSP 1 Score: 57.4 bits (137), Expect = 3.9e-08 Identity = 27/36 (75.00%), Postives = 31/36 (86.11%), Query Frame = 0
BLAST of MC11g1422 vs. ExPASy Swiss-Prot
Match: Q36450 (NADH dehydrogenase [ubiquinone] iron-sulfur protein 2 OS=Nicotiana sylvestris OX=4096 GN=NAD7 PE=2 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 1.5e-07 Identity = 26/36 (72.22%), Postives = 30/36 (83.33%), Query Frame = 0
BLAST of MC11g1422 vs. ExPASy Swiss-Prot
Match: Q9TC96 (NADH dehydrogenase [ubiquinone] iron-sulfur protein 2 OS=Nephroselmis olivacea OX=31312 GN=NAD7 PE=3 SV=1) HSP 1 Score: 50.1 bits (118), Expect = 6.2e-06 Identity = 22/36 (61.11%), Postives = 29/36 (80.56%), Query Frame = 0
BLAST of MC11g1422 vs. ExPASy Swiss-Prot
Match: A5FX11 (NADH-quinone oxidoreductase subunit D OS=Acidiphilium cryptum (strain JF-5) OX=349163 GN=nuoD PE=3 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 8.2e-06 Identity = 21/36 (58.33%), Postives = 30/36 (83.33%), Query Frame = 0
BLAST of MC11g1422 vs. ExPASy Swiss-Prot
Match: Q37720 (NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Pylaiella littoralis OX=2885 GN=NAD7 PE=3 SV=1) HSP 1 Score: 48.5 bits (114), Expect = 1.8e-05 Identity = 22/36 (61.11%), Postives = 27/36 (75.00%), Query Frame = 0
BLAST of MC11g1422 vs. NCBI nr
Match: CBI33445.3 (unnamed protein product, partial [Vitis vinifera]) HSP 1 Score: 58.2 bits (139), Expect = 3.10e-09 Identity = 27/34 (79.41%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of MC11g1422 vs. NCBI nr
Match: KAB5511304.1 (hypothetical protein DKX38_030099 [Salix brachista]) HSP 1 Score: 57.0 bits (136), Expect = 4.08e-09 Identity = 27/34 (79.41%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of MC11g1422 vs. NCBI nr
Match: PIN22208.1 (NADH dehydrogenase [Handroanthus impetiginosus]) HSP 1 Score: 57.0 bits (136), Expect = 4.18e-09 Identity = 27/34 (79.41%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of MC11g1422 vs. NCBI nr
Match: CDY45550.1 (BnaCnng13090D [Brassica napus]) HSP 1 Score: 57.0 bits (136), Expect = 4.18e-09 Identity = 27/34 (79.41%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of MC11g1422 vs. NCBI nr
Match: EEF27243.1 (NADH-ubiquinone oxidoreductase fe-s protein, putative [Ricinus communis] >QGW48465.1 hypothetical protein [Raphanus sativus] >QGW48547.1 hypothetical protein [Raphanus sativus]) HSP 1 Score: 57.0 bits (136), Expect = 4.18e-09 Identity = 27/34 (79.41%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of MC11g1422 vs. ExPASy TrEMBL
Match: A0A1J3EYN1 (NADH dehydrogenase [ubiquinone] iron-sulfur protein 2 (Fragment) OS=Noccaea caerulescens OX=107243 GN=LC_TR13731_c1_g1_i1_g.47718 PE=3 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 1.32e-09 Identity = 27/34 (79.41%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of MC11g1422 vs. ExPASy TrEMBL
Match: D7TSH3 (Complex1_49kDa domain-containing protein OS=Vitis vinifera OX=29760 GN=VIT_00s0332g00140 PE=3 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 1.50e-09 Identity = 27/34 (79.41%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of MC11g1422 vs. ExPASy TrEMBL
Match: A0A5N5J034 (Complex1_49kDa domain-containing protein OS=Salix brachista OX=2182728 GN=DKX38_030099 PE=3 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 1.98e-09 Identity = 27/34 (79.41%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of MC11g1422 vs. ExPASy TrEMBL
Match: A0A251UZT8 (Putative niFe hydrogenase-like protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr04g0109061 PE=3 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 2.02e-09 Identity = 27/34 (79.41%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of MC11g1422 vs. ExPASy TrEMBL
Match: A0A6J5THG3 (Complex1_49kDa domain-containing protein OS=Prunus armeniaca OX=36596 GN=CURHAP_LOCUS3484 PE=3 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 2.02e-09 Identity = 27/34 (79.41%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of MC11g1422 vs. TAIR 10
Match: ATMG00510.1 (NADH dehydrogenase subunit 7 ) HSP 1 Score: 57.4 bits (137), Expect = 2.8e-09 Identity = 27/36 (75.00%), Postives = 31/36 (86.11%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|