
MC11g1336 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTACCTCTTGAAATTCTTTATCGTTACGTCTGGTCTATCTCTCATATACTCATCGTCTGTGGTTGAATCGAGACAAAACCCTAAAATGAGTCTAGCAGCAACGGTAAAGTTGGATGGCGAGACATCCGATTGTTGGGAATCTCTAGTCCAACTCCAAGCATGCACCAGTGAAATTATCACGTTCTTCGTCAATGGTGAAACTTATTTAGGCCCTAGTTGTTGTCAAGCCATTAGGATTATTCAGCATGAGTGTTGGTCTACATTGTTCGGCTCTTTGGGATACACTAATGAAGAAAGTAACATTCTTGAAGCATATTGTGATTCTAGAGTTGATATTGATCTTTCGTCATCGTCACCTTCTCCACCA ATGGCTTACCTCTTGAAATTCTTTATCGTTACGTCTGGTCTATCTCTCATATACTCATCGTCTGTGGTTGAATCGAGACAAAACCCTAAAATGAGTCTAGCAGCAACGGTAAAGTTGGATGGCGAGACATCCGATTGTTGGGAATCTCTAGTCCAACTCCAAGCATGCACCAGTGAAATTATCACGTTCTTCGTCAATGGTGAAACTTATTTAGGCCCTAGTTGTTGTCAAGCCATTAGGATTATTCAGCATGAGTGTTGGTCTACATTGTTCGGCTCTTTGGGATACACTAATGAAGAAAGTAACATTCTTGAAGCATATTGTGATTCTAGAGTTGATATTGATCTTTCGTCATCGTCACCTTCTCCACCA ATGGCTTACCTCTTGAAATTCTTTATCGTTACGTCTGGTCTATCTCTCATATACTCATCGTCTGTGGTTGAATCGAGACAAAACCCTAAAATGAGTCTAGCAGCAACGGTAAAGTTGGATGGCGAGACATCCGATTGTTGGGAATCTCTAGTCCAACTCCAAGCATGCACCAGTGAAATTATCACGTTCTTCGTCAATGGTGAAACTTATTTAGGCCCTAGTTGTTGTCAAGCCATTAGGATTATTCAGCATGAGTGTTGGTCTACATTGTTCGGCTCTTTGGGATACACTAATGAAGAAAGTAACATTCTTGAAGCATATTGTGATTCTAGAGTTGATATTGATCTTTCGTCATCGTCACCTTCTCCACCA MAYLLKFFIVTSGLSLIYSSSVVESRQNPKMSLAATVKLDGETSDCWESLVQLQACTSEIITFFVNGETYLGPSCCQAIRIIQHECWSTLFGSLGYTNEESNILEAYCDSRVDIDLSSSSPSPP Homology
BLAST of MC11g1336 vs. ExPASy Swiss-Prot
Match: Q9SRD8 (Egg cell-secreted protein 1.1 OS=Arabidopsis thaliana OX=3702 GN=EC1.1 PE=2 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 1.0e-23 Identity = 54/117 (46.15%), Postives = 76/117 (64.96%), Query Frame = 0
BLAST of MC11g1336 vs. ExPASy Swiss-Prot
Match: Q9T039 (Egg cell-secreted protein 1.4 OS=Arabidopsis thaliana OX=3702 GN=EC1.4 PE=2 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 3.8e-18 Identity = 51/126 (40.48%), Postives = 75/126 (59.52%), Query Frame = 0
BLAST of MC11g1336 vs. ExPASy Swiss-Prot
Match: Q9SJ24 (Egg cell-secreted protein 1.2 OS=Arabidopsis thaliana OX=3702 GN=EC1.2 PE=2 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 4.2e-17 Identity = 44/123 (35.77%), Postives = 69/123 (56.10%), Query Frame = 0
BLAST of MC11g1336 vs. ExPASy Swiss-Prot
Match: Q9SJ23 (Egg cell-secreted protein 1.3 OS=Arabidopsis thaliana OX=3702 GN=EC1.3 PE=2 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 7.1e-17 Identity = 44/113 (38.94%), Postives = 66/113 (58.41%), Query Frame = 0
BLAST of MC11g1336 vs. ExPASy Swiss-Prot
Match: Q9FGG1 (Egg cell-secreted protein 1.5 OS=Arabidopsis thaliana OX=3702 GN=EC1.5 PE=2 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 1.4e-12 Identity = 41/128 (32.03%), Postives = 64/128 (50.00%), Query Frame = 0
BLAST of MC11g1336 vs. NCBI nr
Match: XP_023524587.1 (egg cell-secreted protein 1.1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 166 bits (421), Expect = 2.48e-50 Identity = 85/122 (69.67%), Postives = 100/122 (81.97%), Query Frame = 0
BLAST of MC11g1336 vs. NCBI nr
Match: KAG6607143.1 (Egg cell-secreted protein 1.1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 164 bits (415), Expect = 2.03e-49 Identity = 83/121 (68.60%), Postives = 98/121 (80.99%), Query Frame = 0
BLAST of MC11g1336 vs. NCBI nr
Match: XP_022998659.1 (egg cell-secreted protein 1.1-like [Cucurbita maxima]) HSP 1 Score: 163 bits (412), Expect = 5.82e-49 Identity = 82/122 (67.21%), Postives = 100/122 (81.97%), Query Frame = 0
BLAST of MC11g1336 vs. NCBI nr
Match: XP_022998660.1 (egg cell-secreted protein 1.1-like [Cucurbita maxima]) HSP 1 Score: 158 bits (400), Expect = 3.90e-47 Identity = 82/122 (67.21%), Postives = 95/122 (77.87%), Query Frame = 0
BLAST of MC11g1336 vs. NCBI nr
Match: XP_023524588.1 (egg cell-secreted protein 1.1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 156 bits (395), Expect = 2.25e-46 Identity = 79/122 (64.75%), Postives = 96/122 (78.69%), Query Frame = 0
BLAST of MC11g1336 vs. ExPASy TrEMBL
Match: A0A6J1KEX2 (egg cell-secreted protein 1.1-like OS=Cucurbita maxima OX=3661 GN=LOC111493240 PE=4 SV=1) HSP 1 Score: 163 bits (412), Expect = 2.82e-49 Identity = 82/122 (67.21%), Postives = 100/122 (81.97%), Query Frame = 0
BLAST of MC11g1336 vs. ExPASy TrEMBL
Match: A0A6J1KD37 (egg cell-secreted protein 1.1-like OS=Cucurbita maxima OX=3661 GN=LOC111493241 PE=4 SV=1) HSP 1 Score: 158 bits (400), Expect = 1.89e-47 Identity = 82/122 (67.21%), Postives = 95/122 (77.87%), Query Frame = 0
BLAST of MC11g1336 vs. ExPASy TrEMBL
Match: A0A0A0LSR4 (Prolamin_like domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G124020 PE=4 SV=1) HSP 1 Score: 155 bits (391), Expect = 4.70e-46 Identity = 76/115 (66.09%), Postives = 89/115 (77.39%), Query Frame = 0
BLAST of MC11g1336 vs. ExPASy TrEMBL
Match: A0A0A0LVH9 (Prolamin_like domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G124010 PE=4 SV=1) HSP 1 Score: 147 bits (371), Expect = 2.32e-43 Identity = 65/100 (65.00%), Postives = 81/100 (81.00%), Query Frame = 0
BLAST of MC11g1336 vs. ExPASy TrEMBL
Match: A0A1S3CM80 (egg cell-secreted protein 1.2-like OS=Cucumis melo OX=3656 GN=LOC103502392 PE=4 SV=1) HSP 1 Score: 146 bits (369), Expect = 1.07e-42 Identity = 74/116 (63.79%), Postives = 87/116 (75.00%), Query Frame = 0
BLAST of MC11g1336 vs. TAIR 10
Match: AT1G76750.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 110.9 bits (276), Expect = 7.3e-25 Identity = 54/117 (46.15%), Postives = 76/117 (64.96%), Query Frame = 0
BLAST of MC11g1336 vs. TAIR 10
Match: AT4G39340.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 92.4 bits (228), Expect = 2.7e-19 Identity = 51/126 (40.48%), Postives = 75/126 (59.52%), Query Frame = 0
BLAST of MC11g1336 vs. TAIR 10
Match: AT2G21740.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 89.0 bits (219), Expect = 3.0e-18 Identity = 44/123 (35.77%), Postives = 69/123 (56.10%), Query Frame = 0
BLAST of MC11g1336 vs. TAIR 10
Match: AT2G21750.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 88.2 bits (217), Expect = 5.1e-18 Identity = 44/113 (38.94%), Postives = 66/113 (58.41%), Query Frame = 0
BLAST of MC11g1336 vs. TAIR 10
Match: AT5G64720.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 73.9 bits (180), Expect = 9.9e-14 Identity = 41/128 (32.03%), Postives = 64/128 (50.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|