
MC11g1335 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.AGTCTAGCAGCAAGGGTAAAATTGGATGGCGAGACATCCGATTGTTGGGGATCTCTAGTTCAACTCCAAACATGCACCAGTGAAATTACTAGTTGTTGTCAAGCCATTAGAATTATTCAGCATGAATGTTGGTCTACATTGTTCGGCTCTTTGGGATACACTAATGAAGAAAGTAACATTCTTGAAGCATACTGTGATTCCACAGTATCGTCACCTTCTCCACCACCACAATCT AGTCTAGCAGCAAGGGTAAAATTGGATGGCGAGACATCCGATTGTTGGGGATCTCTAGTTCAACTCCAAACATGCACCAGTGAAATTACTAGTTGTTGTCAAGCCATTAGAATTATTCAGCATGAATGTTGGTCTACATTGTTCGGCTCTTTGGGATACACTAATGAAGAAAGTAACATTCTTGAAGCATACTGTGATTCCACAGTATCGTCACCTTCTCCACCACCACAATCT AGTCTAGCAGCAAGGGTAAAATTGGATGGCGAGACATCCGATTGTTGGGGATCTCTAGTTCAACTCCAAACATGCACCAGTGAAATTACTAGTTGTTGTCAAGCCATTAGAATTATTCAGCATGAATGTTGGTCTACATTGTTCGGCTCTTTGGGATACACTAATGAAGAAAGTAACATTCTTGAAGCATACTGTGATTCCACAGTATCGTCACCTTCTCCACCACCACAATCT SLAARVKLDGETSDCWGSLVQLQTCTSEITSCCQAIRIIQHECWSTLFGSLGYTNEESNILEAYCDSTVSSPSPPPQS Homology
BLAST of MC11g1335 vs. ExPASy Swiss-Prot
Match: Q9SRD8 (Egg cell-secreted protein 1.1 OS=Arabidopsis thaliana OX=3702 GN=EC1.1 PE=2 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.5e-12 Identity = 35/82 (42.68%), Postives = 47/82 (57.32%), Query Frame = 0
BLAST of MC11g1335 vs. ExPASy Swiss-Prot
Match: Q9SJ24 (Egg cell-secreted protein 1.2 OS=Arabidopsis thaliana OX=3702 GN=EC1.2 PE=2 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 2.4e-10 Identity = 32/90 (35.56%), Postives = 51/90 (56.67%), Query Frame = 0
BLAST of MC11g1335 vs. ExPASy Swiss-Prot
Match: Q9T039 (Egg cell-secreted protein 1.4 OS=Arabidopsis thaliana OX=3702 GN=EC1.4 PE=2 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 2.4e-10 Identity = 34/92 (36.96%), Postives = 55/92 (59.78%), Query Frame = 0
BLAST of MC11g1335 vs. ExPASy Swiss-Prot
Match: Q9SJ23 (Egg cell-secreted protein 1.3 OS=Arabidopsis thaliana OX=3702 GN=EC1.3 PE=2 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 7.7e-09 Identity = 32/90 (35.56%), Postives = 48/90 (53.33%), Query Frame = 0
BLAST of MC11g1335 vs. ExPASy Swiss-Prot
Match: Q9FGG1 (Egg cell-secreted protein 1.5 OS=Arabidopsis thaliana OX=3702 GN=EC1.5 PE=2 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 1.9e-07 Identity = 31/93 (33.33%), Postives = 44/93 (47.31%), Query Frame = 0
BLAST of MC11g1335 vs. NCBI nr
Match: XP_023524587.1 (egg cell-secreted protein 1.1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 106 bits (265), Expect = 2.06e-27 Identity = 55/93 (59.14%), Postives = 66/93 (70.97%), Query Frame = 0
BLAST of MC11g1335 vs. NCBI nr
Match: XP_038895737.1 (egg cell-secreted protein 1.1-like [Benincasa hispida]) HSP 1 Score: 105 bits (261), Expect = 6.30e-27 Identity = 47/81 (58.02%), Postives = 58/81 (71.60%), Query Frame = 0
BLAST of MC11g1335 vs. NCBI nr
Match: KAA0035199.1 (egg cell-secreted protein 1.2-like [Cucumis melo var. makuwa] >TYK21814.1 egg cell-secreted protein 1.2-like [Cucumis melo var. makuwa]) HSP 1 Score: 104 bits (259), Expect = 8.77e-27 Identity = 48/81 (59.26%), Postives = 59/81 (72.84%), Query Frame = 0
BLAST of MC11g1335 vs. NCBI nr
Match: KAG6607143.1 (Egg cell-secreted protein 1.1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 102 bits (255), Expect = 6.78e-26 Identity = 49/81 (60.49%), Postives = 59/81 (72.84%), Query Frame = 0
BLAST of MC11g1335 vs. NCBI nr
Match: XP_022998659.1 (egg cell-secreted protein 1.1-like [Cucurbita maxima]) HSP 1 Score: 102 bits (253), Expect = 1.36e-25 Identity = 48/81 (59.26%), Postives = 58/81 (71.60%), Query Frame = 0
BLAST of MC11g1335 vs. ExPASy TrEMBL
Match: A0A0A0LSR4 (Prolamin_like domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G124020 PE=4 SV=1) HSP 1 Score: 110 bits (274), Expect = 4.54e-29 Identity = 52/81 (64.20%), Postives = 59/81 (72.84%), Query Frame = 0
BLAST of MC11g1335 vs. ExPASy TrEMBL
Match: A0A0A0LVH9 (Prolamin_like domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G124010 PE=4 SV=1) HSP 1 Score: 104 bits (260), Expect = 2.91e-27 Identity = 47/81 (58.02%), Postives = 59/81 (72.84%), Query Frame = 0
BLAST of MC11g1335 vs. ExPASy TrEMBL
Match: A0A5D3DE13 (Egg cell-secreted protein 1.2-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold991G00290 PE=4 SV=1) HSP 1 Score: 104 bits (259), Expect = 4.24e-27 Identity = 48/81 (59.26%), Postives = 59/81 (72.84%), Query Frame = 0
BLAST of MC11g1335 vs. ExPASy TrEMBL
Match: A0A6J1KEX2 (egg cell-secreted protein 1.1-like OS=Cucurbita maxima OX=3661 GN=LOC111493240 PE=4 SV=1) HSP 1 Score: 102 bits (253), Expect = 6.60e-26 Identity = 48/81 (59.26%), Postives = 58/81 (71.60%), Query Frame = 0
BLAST of MC11g1335 vs. ExPASy TrEMBL
Match: A0A6J1KD37 (egg cell-secreted protein 1.1-like OS=Cucurbita maxima OX=3661 GN=LOC111493241 PE=4 SV=1) HSP 1 Score: 101 bits (252), Expect = 9.36e-26 Identity = 48/81 (59.26%), Postives = 57/81 (70.37%), Query Frame = 0
BLAST of MC11g1335 vs. TAIR 10
Match: AT1G76750.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 73.2 bits (178), Expect = 1.1e-13 Identity = 35/82 (42.68%), Postives = 47/82 (57.32%), Query Frame = 0
BLAST of MC11g1335 vs. TAIR 10
Match: AT2G21740.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 65.9 bits (159), Expect = 1.7e-11 Identity = 32/90 (35.56%), Postives = 51/90 (56.67%), Query Frame = 0
BLAST of MC11g1335 vs. TAIR 10
Match: AT4G39340.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 65.9 bits (159), Expect = 1.7e-11 Identity = 34/92 (36.96%), Postives = 55/92 (59.78%), Query Frame = 0
BLAST of MC11g1335 vs. TAIR 10
Match: AT2G21750.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 60.8 bits (146), Expect = 5.4e-10 Identity = 32/90 (35.56%), Postives = 48/90 (53.33%), Query Frame = 0
BLAST of MC11g1335 vs. TAIR 10
Match: AT5G64720.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 56.2 bits (134), Expect = 1.3e-08 Identity = 31/93 (33.33%), Postives = 44/93 (47.31%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|