MC10g0899 (gene) Bitter gourd (Dali-11) v1
|
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TCGCCGCGTAAATTTCTCCTTTTTAGAAGGGCTCCAGTGGCTACATATATATTAAGTCTGGTCGCTCGAACTGTTGTACCTTTTGATTATGGTATGGTATTATCATATCCAAACATAGGACTACTTTTTTTTTTGTCCTTCACTTCGCCGCGTAAATTTCTCCTTTTTAGAAGGGCTCCAGTGGCTACATATATATTAAGTCTGGTCGCTCGAACTGTTGTACCTTTTGATTATGGTATGGTATTATCATATCCAAACATAGGACTACTTTTTTTTTTGTCCTTCACT TCGCCGCGTAAATTTCTCCTTTTTAGAAGGGCTCCAGTGGCTACATATATATTAAGTCTGGTCGCTCGAACTGTTGTACCTTTTGATTATGGTATGGTATTATCATATCCAAACATAGGACTACTTTTTTTTTTGTCCTTCACT SPRKFLLFRRAPVATYILSLVARTVVPFDYGMVLSYPNIGLLFFLSFT Homology
BLAST of MC10g0899 vs. ExPASy Swiss-Prot
Match: Q01300 (NADH-ubiquinone oxidoreductase chain 1 OS=Petunia hybrida OX=4102 GN=ND1 PE=3 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 3.3e-10 Identity = 33/48 (68.75%), Postives = 38/48 (79.17%), Query Frame = 0
BLAST of MC10g0899 vs. ExPASy Swiss-Prot
Match: P92558 (NADH-ubiquinone oxidoreductase chain 1 OS=Arabidopsis thaliana OX=3702 GN=ND1 PE=1 SV=4) HSP 1 Score: 58.5 bits (140), Expect = 2.3e-08 Identity = 31/48 (64.58%), Postives = 36/48 (75.00%), Query Frame = 0
BLAST of MC10g0899 vs. ExPASy Swiss-Prot
Match: Q01148 (NADH-ubiquinone oxidoreductase chain 1 OS=Triticum aestivum OX=4565 GN=ND1 PE=2 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 2.3e-08 Identity = 31/48 (64.58%), Postives = 36/48 (75.00%), Query Frame = 0
BLAST of MC10g0899 vs. ExPASy Swiss-Prot
Match: P31839 (NADH-ubiquinone oxidoreductase chain 1 OS=Oenothera berteroana OX=3950 GN=ND1 PE=2 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 4.0e-08 Identity = 31/48 (64.58%), Postives = 36/48 (75.00%), Query Frame = 0
BLAST of MC10g0899 vs. ExPASy Swiss-Prot
Match: P26845 (NADH-ubiquinone oxidoreductase chain 1 OS=Marchantia polymorpha OX=3197 GN=ND1 PE=3 SV=2) HSP 1 Score: 43.9 bits (102), Expect = 6.0e-04 Identity = 22/48 (45.83%), Postives = 30/48 (62.50%), Query Frame = 0
BLAST of MC10g0899 vs. NCBI nr
Match: PHT75371.1 (hypothetical protein T459_18893 [Capsicum annuum]) HSP 1 Score: 64.3 bits (155), Expect = 3.97e-12 Identity = 33/44 (75.00%), Postives = 37/44 (84.09%), Query Frame = 0
BLAST of MC10g0899 vs. NCBI nr
Match: NP_973440.1 (NADH dehydrogenase family protein [Arabidopsis thaliana] >KAG7529247.1 NADH:ubiquinone oxidoreductase subunit 1/F420H2 oxidoreductase subunit H [Arabidopsis thaliana x Arabidopsis arenosa] >KAG7529347.1 NADH:ubiquinone oxidoreductase subunit 1/F420H2 oxidoreductase subunit H [Arabidopsis suecica] >QGW48372.1 hypothetical protein [Raphanus sativus] >AEC06083.1 NADH dehydrogenase family protein [Arabidopsis thaliana] >KAG7531412.1 NADH:ubiquinone oxidoreductase subunit 1/F420H2 oxidoreductase subunit H [Arabidopsis suecica]) HSP 1 Score: 65.1 bits (157), Expect = 4.94e-12 Identity = 33/48 (68.75%), Postives = 38/48 (79.17%), Query Frame = 0
BLAST of MC10g0899 vs. NCBI nr
Match: PHT70336.1 (NADH-ubiquinone oxidoreductase chain 1 [Capsicum annuum]) HSP 1 Score: 65.5 bits (158), Expect = 7.09e-12 Identity = 34/48 (70.83%), Postives = 38/48 (79.17%), Query Frame = 0
BLAST of MC10g0899 vs. NCBI nr
Match: KAG6621639.1 (hypothetical protein I3842_Q005600, partial [Carya illinoinensis]) HSP 1 Score: 64.3 bits (155), Expect = 8.79e-12 Identity = 33/48 (68.75%), Postives = 38/48 (79.17%), Query Frame = 0
BLAST of MC10g0899 vs. NCBI nr
Match: AOF46967.1 (NADH dehydrogenase subunit 1, partial [Hydrocharis morsus-ranae]) HSP 1 Score: 65.1 bits (157), Expect = 9.81e-12 Identity = 33/48 (68.75%), Postives = 38/48 (79.17%), Query Frame = 0
BLAST of MC10g0899 vs. ExPASy TrEMBL
Match: A0A2G2Z0F0 (Uncharacterized protein OS=Capsicum annuum OX=4072 GN=T459_18893 PE=3 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 1.92e-12 Identity = 33/44 (75.00%), Postives = 37/44 (84.09%), Query Frame = 0
BLAST of MC10g0899 vs. ExPASy TrEMBL
Match: A0A654GF24 (Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AN1_LOCUS27134 PE=3 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 2.39e-12 Identity = 33/48 (68.75%), Postives = 38/48 (79.17%), Query Frame = 0
BLAST of MC10g0899 vs. ExPASy TrEMBL
Match: A0A650GCH3 (NADH-ubiquinone oxidoreductase chain 1 OS=Raphanus sativus OX=3726 GN=orf99a PE=3 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 2.39e-12 Identity = 33/48 (68.75%), Postives = 38/48 (79.17%), Query Frame = 0
BLAST of MC10g0899 vs. ExPASy TrEMBL
Match: Q3EC42 (NADH dehydrogenase family protein OS=Arabidopsis thaliana OX=3702 GN=At2g07785 PE=3 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 2.39e-12 Identity = 33/48 (68.75%), Postives = 38/48 (79.17%), Query Frame = 0
BLAST of MC10g0899 vs. ExPASy TrEMBL
Match: A0A453KTL0 (Uncharacterized protein OS=Aegilops tauschii subsp. strangulata OX=200361 PE=3 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 2.58e-12 Identity = 33/48 (68.75%), Postives = 38/48 (79.17%), Query Frame = 0
BLAST of MC10g0899 vs. TAIR 10
Match: AT2G07785.1 (NADH dehydrogenase family protein ) HSP 1 Score: 65.5 bits (158), Expect = 1.4e-11 Identity = 33/48 (68.75%), Postives = 38/48 (79.17%), Query Frame = 0
BLAST of MC10g0899 vs. TAIR 10
Match: ATMG01120.1 (NADH dehydrogenase 1B ) HSP 1 Score: 65.5 bits (158), Expect = 1.4e-11 Identity = 33/48 (68.75%), Postives = 38/48 (79.17%), Query Frame = 0
BLAST of MC10g0899 vs. TAIR 10
Match: ATMG00516.1 (NADH dehydrogenase 1C ) HSP 1 Score: 65.5 bits (158), Expect = 1.4e-11 Identity = 33/48 (68.75%), Postives = 38/48 (79.17%), Query Frame = 0
BLAST of MC10g0899 vs. TAIR 10
Match: ATMG01275.1 (NADH dehydrogenase 1A ) HSP 1 Score: 65.5 bits (158), Expect = 1.4e-11 Identity = 33/48 (68.75%), Postives = 38/48 (79.17%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|