MC10g0377 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TGTGACAAACAGTGCAAGAAGAGATGCTCAAAAGCAGGAGTGATGGACAGATGCATAAAGTATTGTGGAATTTGCTGTGGCTATTGCAAGTGTGTTCCTTCTGGGACTTATGGGAACAAGCATGAGTGCCCTTGCTATAGGGACATGAGGAGTTCTAAGGGTAAGCCCAAGTGCCCT TGTGACAAACAGTGCAAGAAGAGATGCTCAAAAGCAGGAGTGATGGACAGATGCATAAAGTATTGTGGAATTTGCTGTGGCTATTGCAAGTGTGTTCCTTCTGGGACTTATGGGAACAAGCATGAGTGCCCTTGCTATAGGGACATGAGGAGTTCTAAGGGTAAGCCCAAGTGCCCT TGTGACAAACAGTGCAAGAAGAGATGCTCAAAAGCAGGAGTGATGGACAGATGCATAAAGTATTGTGGAATTTGCTGTGGCTATTGCAAGTGTGTTCCTTCTGGGACTTATGGGAACAAGCATGAGTGCCCTTGCTATAGGGACATGAGGAGTTCTAAGGGTAAGCCCAAGTGCCCT CDKQCKKRCSKAGVMDRCIKYCGICCGYCKCVPSGTYGNKHECPCYRDMRSSKGKPKCP Homology
BLAST of MC10g0377 vs. ExPASy Swiss-Prot
Match: Q948Z4 (Snakin-1 OS=Solanum tuberosum OX=4113 GN=SN1 PE=1 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 2.6e-25 Identity = 47/59 (79.66%), Postives = 52/59 (88.14%), Query Frame = 0
BLAST of MC10g0377 vs. ExPASy Swiss-Prot
Match: P86888 (Peamaclein OS=Prunus persica OX=3760 PE=1 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 7.1e-23 Identity = 43/59 (72.88%), Postives = 49/59 (83.05%), Query Frame = 0
BLAST of MC10g0377 vs. ExPASy Swiss-Prot
Match: O82328 (Gibberellin-regulated protein 7 OS=Arabidopsis thaliana OX=3702 GN=GASA7 PE=3 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 7.8e-22 Identity = 42/59 (71.19%), Postives = 49/59 (83.05%), Query Frame = 0
BLAST of MC10g0377 vs. ExPASy Swiss-Prot
Match: C0HLQ1 (Cypmaclein OS=Cryptomeria japonica OX=3369 PE=1 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 7.3e-20 Identity = 38/59 (64.41%), Postives = 46/59 (77.97%), Query Frame = 0
BLAST of MC10g0377 vs. ExPASy Swiss-Prot
Match: Q8LFM2 (Gibberellin-regulated protein 10 OS=Arabidopsis thaliana OX=3702 GN=GASA10 PE=2 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 1.2e-19 Identity = 42/60 (70.00%), Postives = 46/60 (76.67%), Query Frame = 0
BLAST of MC10g0377 vs. NCBI nr
Match: XP_022149266.1 (peamaclein-like [Momordica charantia]) HSP 1 Score: 139 bits (349), Expect = 3.33e-41 Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 0
BLAST of MC10g0377 vs. NCBI nr
Match: XP_038906246.1 (peamaclein-like [Benincasa hispida]) HSP 1 Score: 134 bits (338), Expect = 1.59e-39 Identity = 57/59 (96.61%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MC10g0377 vs. NCBI nr
Match: KAE8649034.1 (hypothetical protein Csa_014887 [Cucumis sativus]) HSP 1 Score: 134 bits (336), Expect = 3.21e-39 Identity = 56/59 (94.92%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MC10g0377 vs. NCBI nr
Match: KAA0044354.1 (peamaclein-like [Cucumis melo var. makuwa] >TYK29483.1 peamaclein-like [Cucumis melo var. makuwa]) HSP 1 Score: 131 bits (330), Expect = 2.64e-38 Identity = 54/59 (91.53%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MC10g0377 vs. NCBI nr
Match: PON74748.1 (Gibberellin regulated protein [Parasponia andersonii]) HSP 1 Score: 121 bits (304), Expect = 2.75e-34 Identity = 51/59 (86.44%), Postives = 54/59 (91.53%), Query Frame = 0
BLAST of MC10g0377 vs. ExPASy TrEMBL
Match: A0A6J1D7V8 (peamaclein-like OS=Momordica charantia OX=3673 GN=LOC111017729 PE=3 SV=1) HSP 1 Score: 139 bits (349), Expect = 1.61e-41 Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 0
BLAST of MC10g0377 vs. ExPASy TrEMBL
Match: A0A5D3E0A6 (Peamaclein-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold655G00810 PE=3 SV=1) HSP 1 Score: 131 bits (330), Expect = 1.28e-38 Identity = 54/59 (91.53%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MC10g0377 vs. ExPASy TrEMBL
Match: A0A2P5DN83 (Gibberellin regulated protein OS=Parasponia andersonii OX=3476 GN=PanWU01x14_048070 PE=3 SV=1) HSP 1 Score: 121 bits (304), Expect = 1.33e-34 Identity = 51/59 (86.44%), Postives = 54/59 (91.53%), Query Frame = 0
BLAST of MC10g0377 vs. ExPASy TrEMBL
Match: A0A7D5NHE3 (Snakin 2 OS=Ocimum basilicum OX=39350 PE=2 SV=1) HSP 1 Score: 121 bits (303), Expect = 1.68e-34 Identity = 50/59 (84.75%), Postives = 53/59 (89.83%), Query Frame = 0
BLAST of MC10g0377 vs. ExPASy TrEMBL
Match: B9R733 (GAST1 protein, putative OS=Ricinus communis OX=3988 GN=RCOM_1588210 PE=3 SV=1) HSP 1 Score: 120 bits (301), Expect = 3.30e-34 Identity = 49/59 (83.05%), Postives = 54/59 (91.53%), Query Frame = 0
BLAST of MC10g0377 vs. TAIR 10
Match: AT2G14900.1 (Gibberellin-regulated family protein ) HSP 1 Score: 103.6 bits (257), Expect = 5.5e-23 Identity = 42/59 (71.19%), Postives = 49/59 (83.05%), Query Frame = 0
BLAST of MC10g0377 vs. TAIR 10
Match: AT5G59845.1 (Gibberellin-regulated family protein ) HSP 1 Score: 96.3 bits (238), Expect = 8.8e-21 Identity = 42/60 (70.00%), Postives = 46/60 (76.67%), Query Frame = 0
BLAST of MC10g0377 vs. TAIR 10
Match: AT2G39540.1 (Gibberellin-regulated family protein ) HSP 1 Score: 93.2 bits (230), Expect = 7.5e-20 Identity = 38/59 (64.41%), Postives = 45/59 (76.27%), Query Frame = 0
BLAST of MC10g0377 vs. TAIR 10
Match: AT1G10588.1 (Gibberellin-regulated family protein ) HSP 1 Score: 84.3 bits (207), Expect = 3.5e-17 Identity = 37/60 (61.67%), Postives = 43/60 (71.67%), Query Frame = 0
BLAST of MC10g0377 vs. TAIR 10
Match: AT1G10588.2 (Gibberellin-regulated family protein ) HSP 1 Score: 84.3 bits (207), Expect = 3.5e-17 Identity = 37/60 (61.67%), Postives = 43/60 (71.67%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
|