MC09g0999 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GAGAGAGGTTTATTCAAACTCTCCATATATTTGCCTCCCGAGTATCCAATGAAGCCACCAAAAGTTACCTTCAAAACTAAAATTTACCATCCTAACATCAATAGTAAAGGTAATATTTGCCTTGACATTCTCAAGGGAAATTGGAGTCCTGCCTTTACACTTTCAAGTGTGTTGGTTGCC GAGAGAGGTTTATTCAAACTCTCCATATATTTGCCTCCCGAGTATCCAATGAAGCCACCAAAAGTTACCTTCAAAACTAAAATTTACCATCCTAACATCAATAGTAAAGGTAATATTTGCCTTGACATTCTCAAGGGAAATTGGAGTCCTGCCTTTACACTTTCAAGTGTGTTGGTTGCC GAGAGAGGTTTATTCAAACTCTCCATATATTTGCCTCCCGAGTATCCAATGAAGCCACCAAAAGTTACCTTCAAAACTAAAATTTACCATCCTAACATCAATAGTAAAGGTAATATTTGCCTTGACATTCTCAAGGGAAATTGGAGTCCTGCCTTTACACTTTCAAGTGTGTTGGTTGCC ERGLFKLSIYLPPEYPMKPPKVTFKTKIYHPNINSKGNICLDILKGNWSPAFTLSSVLVA Homology
BLAST of MC09g0999 vs. ExPASy Swiss-Prot
Match: P35134 (Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis thaliana OX=3702 GN=UBC11 PE=1 SV=2) HSP 1 Score: 95.1 bits (235), Expect = 2.8e-19 Identity = 40/58 (68.97%), Postives = 50/58 (86.21%), Query Frame = 0
BLAST of MC09g0999 vs. ExPASy Swiss-Prot
Match: P15732 (Ubiquitin-conjugating enzyme E2-16 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC5 PE=1 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 8.2e-19 Identity = 42/58 (72.41%), Postives = 47/58 (81.03%), Query Frame = 0
BLAST of MC09g0999 vs. ExPASy Swiss-Prot
Match: Q9SLE4 (Ubiquitin-conjugating enzyme E2 29 OS=Arabidopsis thaliana OX=3702 GN=UBC29 PE=2 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 1.1e-18 Identity = 38/58 (65.52%), Postives = 49/58 (84.48%), Query Frame = 0
BLAST of MC09g0999 vs. ExPASy Swiss-Prot
Match: P15731 (Ubiquitin-conjugating enzyme E2 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC4 PE=1 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 1.8e-18 Identity = 40/58 (68.97%), Postives = 48/58 (82.76%), Query Frame = 0
BLAST of MC09g0999 vs. ExPASy Swiss-Prot
Match: Q9FKT3 (Ubiquitin-conjugating enzyme E2 30 OS=Arabidopsis thaliana OX=3702 GN=UBC30 PE=1 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 2.4e-18 Identity = 38/58 (65.52%), Postives = 49/58 (84.48%), Query Frame = 0
BLAST of MC09g0999 vs. NCBI nr
Match: XP_022157782.1 (ubiquitin-conjugating enzyme E2 11-like [Momordica charantia]) HSP 1 Score: 127 bits (320), Expect = 6.40e-36 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 0
BLAST of MC09g0999 vs. NCBI nr
Match: GAV64832.1 (UQ_con domain-containing protein [Cephalotus follicularis]) HSP 1 Score: 95.9 bits (237), Expect = 2.14e-23 Identity = 40/58 (68.97%), Postives = 51/58 (87.93%), Query Frame = 0
BLAST of MC09g0999 vs. NCBI nr
Match: KAG8483662.1 (hypothetical protein CXB51_022511 [Gossypium anomalum]) HSP 1 Score: 94.7 bits (234), Expect = 2.36e-23 Identity = 41/58 (70.69%), Postives = 50/58 (86.21%), Query Frame = 0
BLAST of MC09g0999 vs. NCBI nr
Match: KAB2065921.1 (hypothetical protein ES319_A09G124300v1 [Gossypium barbadense] >TYI10413.1 hypothetical protein ES332_A09G140100v1 [Gossypium tomentosum] >TYJ18480.1 hypothetical protein E1A91_A09G126300v1 [Gossypium mustelinum]) HSP 1 Score: 95.5 bits (236), Expect = 3.04e-23 Identity = 40/58 (68.97%), Postives = 51/58 (87.93%), Query Frame = 0
BLAST of MC09g0999 vs. NCBI nr
Match: TYH02494.1 (hypothetical protein ES288_A09G145100v1 [Gossypium darwinii]) HSP 1 Score: 95.5 bits (236), Expect = 3.04e-23 Identity = 40/58 (68.97%), Postives = 51/58 (87.93%), Query Frame = 0
BLAST of MC09g0999 vs. ExPASy TrEMBL
Match: A0A6J1DVE6 (ubiquitin-conjugating enzyme E2 11-like OS=Momordica charantia OX=3673 GN=LOC111024403 PE=3 SV=1) HSP 1 Score: 127 bits (320), Expect = 3.10e-36 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 0
BLAST of MC09g0999 vs. ExPASy TrEMBL
Match: A0A1Q3BAK5 (UQ_con domain-containing protein OS=Cephalotus follicularis OX=3775 GN=CFOL_v3_08347 PE=3 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 1.04e-23 Identity = 40/58 (68.97%), Postives = 51/58 (87.93%), Query Frame = 0
BLAST of MC09g0999 vs. ExPASy TrEMBL
Match: A0A5D2P3L5 (UBC core domain-containing protein OS=Gossypium tomentosum OX=34277 GN=ES332_A09G140100v1 PE=3 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 1.47e-23 Identity = 40/58 (68.97%), Postives = 51/58 (87.93%), Query Frame = 0
BLAST of MC09g0999 vs. ExPASy TrEMBL
Match: A0A5J5UDT4 (UBC core domain-containing protein OS=Gossypium barbadense OX=3634 GN=ES319_A09G124300v1 PE=3 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 1.47e-23 Identity = 40/58 (68.97%), Postives = 51/58 (87.93%), Query Frame = 0
BLAST of MC09g0999 vs. ExPASy TrEMBL
Match: A0A5D2F8V7 (UBC core domain-containing protein OS=Gossypium darwinii OX=34276 GN=ES288_A09G145100v1 PE=3 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 1.47e-23 Identity = 40/58 (68.97%), Postives = 51/58 (87.93%), Query Frame = 0
BLAST of MC09g0999 vs. TAIR 10
Match: AT3G08690.1 (ubiquitin-conjugating enzyme 11 ) HSP 1 Score: 95.1 bits (235), Expect = 2.0e-20 Identity = 40/58 (68.97%), Postives = 50/58 (86.21%), Query Frame = 0
BLAST of MC09g0999 vs. TAIR 10
Match: AT3G08690.2 (ubiquitin-conjugating enzyme 11 ) HSP 1 Score: 95.1 bits (235), Expect = 2.0e-20 Identity = 40/58 (68.97%), Postives = 50/58 (86.21%), Query Frame = 0
BLAST of MC09g0999 vs. TAIR 10
Match: AT2G16740.1 (ubiquitin-conjugating enzyme 29 ) HSP 1 Score: 93.2 bits (230), Expect = 7.6e-20 Identity = 38/58 (65.52%), Postives = 49/58 (84.48%), Query Frame = 0
BLAST of MC09g0999 vs. TAIR 10
Match: AT5G56150.1 (ubiquitin-conjugating enzyme 30 ) HSP 1 Score: 92.0 bits (227), Expect = 1.7e-19 Identity = 38/58 (65.52%), Postives = 49/58 (84.48%), Query Frame = 0
BLAST of MC09g0999 vs. TAIR 10
Match: AT5G56150.2 (ubiquitin-conjugating enzyme 30 ) HSP 1 Score: 92.0 bits (227), Expect = 1.7e-19 Identity = 38/58 (65.52%), Postives = 49/58 (84.48%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|