MC08g1400 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGTTTGGCACCAAGGTGAAAAAAGGTGTAGACGGTAGAAGGGGTGGCGGTCCTAAGAAAAAGTCGGTGTCTCGCTCTATGAAAGTCAGCCTGCACTTTCCGGTC ATGGAGTTTGGCACCAAGGTGAAAAAAGGTGTAGACGGTAGAAGGGGTGGCGGTCCTAAGAAAAAGTCGGTGTCTCGCTCTATGAAAGTCAGCCTGCACTTTCCGGTC ATGGAGTTTGGCACCAAGGTGAAAAAAGGTGTAGACGGTAGAAGGGGTGGCGGTCCTAAGAAAAAGTCGGTGTCTCGCTCTATGAAAGTCAGCCTGCACTTTCCGGTC MEFGTKVKKGVDGRRGGGPKKKSVSRSMKVSLHFPV Homology
BLAST of MC08g1400 vs. ExPASy Swiss-Prot
Match: Q9LZ46 (Probable histone H2A.4 OS=Arabidopsis thaliana OX=3702 GN=At5g02560 PE=1 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 3.7e-06 Identity = 27/37 (72.97%), Postives = 29/37 (78.38%), Query Frame = 0
BLAST of MC08g1400 vs. ExPASy Swiss-Prot
Match: P40281 (Histone H2A.2 OS=Pisum sativum OX=3888 PE=2 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 4.8e-06 Identity = 22/36 (61.11%), Postives = 29/36 (80.56%), Query Frame = 0
BLAST of MC08g1400 vs. ExPASy Swiss-Prot
Match: P25470 (Histone H2A.1 OS=Pisum sativum OX=3888 PE=2 SV=1) HSP 1 Score: 50.1 bits (118), Expect = 6.2e-06 Identity = 22/36 (61.11%), Postives = 28/36 (77.78%), Query Frame = 0
BLAST of MC08g1400 vs. ExPASy Swiss-Prot
Match: Q2HU65 (Probable histone H2A.2 OS=Medicago truncatula OX=3880 GN=MtrDRAFT_AC149210g4v1 PE=3 SV=1) HSP 1 Score: 50.1 bits (118), Expect = 6.2e-06 Identity = 22/36 (61.11%), Postives = 28/36 (77.78%), Query Frame = 0
BLAST of MC08g1400 vs. ExPASy Swiss-Prot
Match: Q9M531 (Histone H2A OS=Euphorbia esula OX=3993 PE=2 SV=1) HSP 1 Score: 49.3 bits (116), Expect = 1.1e-05 Identity = 23/36 (63.89%), Postives = 27/36 (75.00%), Query Frame = 0
BLAST of MC08g1400 vs. NCBI nr
Match: CAF1877568.1 (unnamed protein product [Brassica napus]) HSP 1 Score: 56.6 bits (135), Expect = 5.79e-09 Identity = 27/36 (75.00%), Postives = 29/36 (80.56%), Query Frame = 0
BLAST of MC08g1400 vs. NCBI nr
Match: VDD18100.1 (unnamed protein product [Brassica oleracea]) HSP 1 Score: 56.6 bits (135), Expect = 1.07e-08 Identity = 27/36 (75.00%), Postives = 29/36 (80.56%), Query Frame = 0
BLAST of MC08g1400 vs. NCBI nr
Match: XP_009125454.1 (probable histone H2A.4 [Brassica rapa] >KAG5407991.1 hypothetical protein IGI04_004310 [Brassica rapa subsp. trilocularis] >RID72876.1 hypothetical protein BRARA_B00055 [Brassica rapa]) HSP 1 Score: 56.6 bits (135), Expect = 1.87e-08 Identity = 27/36 (75.00%), Postives = 29/36 (80.56%), Query Frame = 0
BLAST of MC08g1400 vs. NCBI nr
Match: KAG2310327.1 (hypothetical protein Bca52824_021884 [Brassica carinata]) HSP 1 Score: 56.6 bits (135), Expect = 1.87e-08 Identity = 27/36 (75.00%), Postives = 29/36 (80.56%), Query Frame = 0
BLAST of MC08g1400 vs. NCBI nr
Match: KAG1337907.1 (histone H2A [Cocos nucifera]) HSP 1 Score: 55.8 bits (133), Expect = 3.39e-08 Identity = 27/36 (75.00%), Postives = 28/36 (77.78%), Query Frame = 0
BLAST of MC08g1400 vs. ExPASy TrEMBL
Match: A0A3P6CU84 (Histone H2A OS=Brassica oleracea OX=3712 GN=BOLC2T06053H PE=3 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 5.20e-09 Identity = 27/36 (75.00%), Postives = 29/36 (80.56%), Query Frame = 0
BLAST of MC08g1400 vs. ExPASy TrEMBL
Match: M4EJA3 (Histone H2A OS=Brassica rapa subsp. pekinensis OX=51351 PE=3 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 9.03e-09 Identity = 27/36 (75.00%), Postives = 29/36 (80.56%), Query Frame = 0
BLAST of MC08g1400 vs. ExPASy TrEMBL
Match: A0A398AC63 (Histone H2A OS=Brassica campestris OX=3711 GN=BRARA_B00055 PE=3 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 9.03e-09 Identity = 27/36 (75.00%), Postives = 29/36 (80.56%), Query Frame = 0
BLAST of MC08g1400 vs. ExPASy TrEMBL
Match: A0A7J8WRZ2 (Histone H2A (Fragment) OS=Gossypium aridum OX=34290 GN=Goari_018850 PE=3 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 1.80e-08 Identity = 25/36 (69.44%), Postives = 29/36 (80.56%), Query Frame = 0
BLAST of MC08g1400 vs. ExPASy TrEMBL
Match: A0A6P6ARG9 (Histone H2A OS=Durio zibethinus OX=66656 GN=LOC111311915 PE=3 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 2.56e-08 Identity = 26/36 (72.22%), Postives = 29/36 (80.56%), Query Frame = 0
BLAST of MC08g1400 vs. TAIR 10
Match: AT5G02560.1 (histone H2A 12 ) HSP 1 Score: 50.8 bits (120), Expect = 2.6e-07 Identity = 27/37 (72.97%), Postives = 29/37 (78.38%), Query Frame = 0
BLAST of MC08g1400 vs. TAIR 10
Match: AT5G02560.2 (histone H2A 12 ) HSP 1 Score: 50.8 bits (120), Expect = 2.6e-07 Identity = 27/37 (72.97%), Postives = 29/37 (78.38%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|