MC08g1162 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TGCGTGAACAGGTTAATTCCCTGCTTAAGTTACCTCAACGGAACCCGAGACCCGCCGGAGAGTTGTTGTGATCCTCTGAGACGGGTGATCGAGTCGAATCCAGATTGCCTTTGCAGTTTAATTAGCATGGAGGGAAGCAATCGAGCGGAGCAGGCTGGCATTGATGTCAACGAGGCTCAACAGCTGCCTGGCAGATGTGGGCAACATGTCAATCCACTCTCC TGCGTGAACAGGTTAATTCCCTGCTTAAGTTACCTCAACGGAACCCGAGACCCGCCGGAGAGTTGTTGTGATCCTCTGAGACGGGTGATCGAGTCGAATCCAGATTGCCTTTGCAGTTTAATTAGCATGGAGGGAAGCAATCGAGCGGAGCAGGCTGGCATTGATGTCAACGAGGCTCAACAGCTGCCTGGCAGATGTGGGCAACATGTCAATCCACTCTCC TGCGTGAACAGGTTAATTCCCTGCTTAAGTTACCTCAACGGAACCCGAGACCCGCCGGAGAGTTGTTGTGATCCTCTGAGACGGGTGATCGAGTCGAATCCAGATTGCCTTTGCAGTTTAATTAGCATGGAGGGAAGCAATCGAGCGGAGCAGGCTGGCATTGATGTCAACGAGGCTCAACAGCTGCCTGGCAGATGTGGGCAACATGTCAATCCACTCTCC CVNRLIPCLSYLNGTRDPPESCCDPLRRVIESNPDCLCSLISMEGSNRAEQAGIDVNEAQQLPGRCGQHVNPLS Homology
BLAST of MC08g1162 vs. ExPASy Swiss-Prot
Match: Q9FFY3 (Non-specific lipid transfer protein GPI-anchored 30 OS=Arabidopsis thaliana OX=3702 GN=LTPG30 PE=2 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 1.6e-24 Identity = 45/74 (60.81%), Postives = 63/74 (85.14%), Query Frame = 0
BLAST of MC08g1162 vs. ExPASy Swiss-Prot
Match: Q9LJ86 (Non-specific lipid transfer protein GPI-anchored 5 OS=Arabidopsis thaliana OX=3702 GN=LTPG5 PE=2 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 6.6e-10 Identity = 34/80 (42.50%), Postives = 48/80 (60.00%), Query Frame = 0
BLAST of MC08g1162 vs. ExPASy Swiss-Prot
Match: Q9LZH5 (Non-specific lipid transfer protein GPI-anchored 2 OS=Arabidopsis thaliana OX=3702 GN=LTPG2 PE=2 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 9.8e-06 Identity = 27/67 (40.30%), Postives = 40/67 (59.70%), Query Frame = 0
BLAST of MC08g1162 vs. ExPASy Swiss-Prot
Match: Q1PFD8 (Non-specific lipid transfer protein GPI-anchored 9 OS=Arabidopsis thaliana OX=3702 GN=LTPG9 PE=2 SV=1) HSP 1 Score: 50.1 bits (118), Expect = 1.3e-05 Identity = 24/73 (32.88%), Postives = 37/73 (50.68%), Query Frame = 0
BLAST of MC08g1162 vs. ExPASy Swiss-Prot
Match: Q9LE56 (Non-specific lipid transfer protein GPI-anchored 3 OS=Arabidopsis thaliana OX=3702 GN=LTPG3 PE=2 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 1.7e-05 Identity = 20/67 (29.85%), Postives = 34/67 (50.75%), Query Frame = 0
BLAST of MC08g1162 vs. NCBI nr
Match: XP_022148259.1 (lipid transfer-like protein VAS [Momordica charantia]) HSP 1 Score: 162 bits (410), Expect = 1.89e-49 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 0
BLAST of MC08g1162 vs. NCBI nr
Match: KAG6581146.1 (Lipid transfer-like protein VAS, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 138 bits (347), Expect = 6.15e-40 Identity = 59/74 (79.73%), Postives = 70/74 (94.59%), Query Frame = 0
BLAST of MC08g1162 vs. NCBI nr
Match: XP_022935175.1 (lipid transfer-like protein VAS [Cucurbita moschata]) HSP 1 Score: 138 bits (347), Expect = 6.15e-40 Identity = 59/74 (79.73%), Postives = 70/74 (94.59%), Query Frame = 0
BLAST of MC08g1162 vs. NCBI nr
Match: XP_023528269.1 (lipid transfer-like protein VAS [Cucurbita pepo subsp. pepo]) HSP 1 Score: 137 bits (346), Expect = 8.72e-40 Identity = 59/74 (79.73%), Postives = 70/74 (94.59%), Query Frame = 0
BLAST of MC08g1162 vs. NCBI nr
Match: XP_022983266.1 (lipid transfer-like protein VAS [Cucurbita maxima]) HSP 1 Score: 137 bits (346), Expect = 1.05e-39 Identity = 59/74 (79.73%), Postives = 70/74 (94.59%), Query Frame = 0
BLAST of MC08g1162 vs. ExPASy TrEMBL
Match: A0A6J1D3G9 (lipid transfer-like protein VAS OS=Momordica charantia OX=3673 GN=LOC111016964 PE=3 SV=1) HSP 1 Score: 162 bits (410), Expect = 9.14e-50 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 0
BLAST of MC08g1162 vs. ExPASy TrEMBL
Match: A0A6J1F9V7 (lipid transfer-like protein VAS OS=Cucurbita moschata OX=3662 GN=LOC111442128 PE=3 SV=1) HSP 1 Score: 138 bits (347), Expect = 2.98e-40 Identity = 59/74 (79.73%), Postives = 70/74 (94.59%), Query Frame = 0
BLAST of MC08g1162 vs. ExPASy TrEMBL
Match: A0A6J1J1M2 (lipid transfer-like protein VAS OS=Cucurbita maxima OX=3661 GN=LOC111481899 PE=3 SV=1) HSP 1 Score: 137 bits (346), Expect = 5.06e-40 Identity = 59/74 (79.73%), Postives = 70/74 (94.59%), Query Frame = 0
BLAST of MC08g1162 vs. ExPASy TrEMBL
Match: A0A0A0L9L7 (AAI domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_3G250900 PE=3 SV=1) HSP 1 Score: 137 bits (344), Expect = 1.02e-39 Identity = 59/74 (79.73%), Postives = 66/74 (89.19%), Query Frame = 0
BLAST of MC08g1162 vs. ExPASy TrEMBL
Match: A0A5A7U4K4 (Lipid transfer-like protein VAS OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold600G001950 PE=3 SV=1) HSP 1 Score: 136 bits (342), Expect = 1.72e-39 Identity = 58/74 (78.38%), Postives = 65/74 (87.84%), Query Frame = 0
BLAST of MC08g1162 vs. TAIR 10
Match: AT5G13900.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 112.8 bits (281), Expect = 1.1e-25 Identity = 45/74 (60.81%), Postives = 63/74 (85.14%), Query Frame = 0
BLAST of MC08g1162 vs. TAIR 10
Match: AT3G22600.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 64.3 bits (155), Expect = 4.7e-11 Identity = 34/80 (42.50%), Postives = 48/80 (60.00%), Query Frame = 0
BLAST of MC08g1162 vs. TAIR 10
Match: AT3G43720.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 50.4 bits (119), Expect = 7.0e-07 Identity = 27/67 (40.30%), Postives = 40/67 (59.70%), Query Frame = 0
BLAST of MC08g1162 vs. TAIR 10
Match: AT3G43720.2 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 50.4 bits (119), Expect = 7.0e-07 Identity = 27/67 (40.30%), Postives = 40/67 (59.70%), Query Frame = 0
BLAST of MC08g1162 vs. TAIR 10
Match: AT1G73560.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 50.1 bits (118), Expect = 9.1e-07 Identity = 24/73 (32.88%), Postives = 37/73 (50.68%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|