
MC08g0733 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TTCATTCAAGCGGGATCTGAAGTATCTACTTTACTAGGTAGAATGCCTTCTAATGTGGGTTATCAACTCACTCTTCGTATCGAAATGAGTTCCTTGTAAGAAAGAATTACTTCTATAAAGGAAGGGTCCATAACTTCTATTCAAGTAGTTTATGTATCTATGGACGATTTGACCAATCCTACTCTTGTCATGATAATTGCACATTTAGATGCTACTCTCATATAATATCAAGAGAATGATCTGCCAAAGGTATATTCTTTAGATTCGACATCTAACTATGCTACAACCTCGAATTGTTGGTGAAGAACATTATGAAACT TTCATTCAAGCGGGATCTGAAGTATCTACTTTACTAGGTAGAATGCCTTCTAATGTGGGTTATCAACTCACTCTTCGTATCGAAATGAGTTCCTTGTAAGAAAGAATTACTTCTATAAAGGAAGGGTCCATAACTTCTATTCAAGTAGTTTATGTATCTATGGACGATTTGACCAATCCTACTCTTGTCATGATAATTGCACATTTAGATGCTACTCTCATATAATATCAAGAGAATGATCTGCCAAAGGTATATTCTTTAGATTCGACAACTATGCTACAACCTCGAATTGTTGGTGAAGAACATTATGAAACT TTCATTCAAGCGGGATCTGAAGTATCTACTTTACTAGGTAGAATGCCTTCTAATGTGGGTTATCAACTCACTCTTCGTATCGAAATGAGTTCCTTGTAAGAAAGAATTACTTCTATAAAGGAAGGGTCCATAACTTCTATTCAAGTAGTTTATGTATCTATGGACGATTTGACCAATCCTACTCTTGTCATGATAATTGCACATTTAGATGCTACTCTCATATAATATCAAGAGAATGATCTGCCAAAGGTATATTCTTTAGATTCGACAACTATGCTACAACCTCGAATTGTTGGTGAAGAACATTATGAAACT FIQAGSEVSTLLGRMPSNVGYQLTLRIEMSSLUERITSIKEGSITSIQVVYVSMDDLTNPTLVMIIAHLDATLIUYQENDLPKVYSLDSTTMLQPRIVGEEHYET Homology
BLAST of MC08g0733 vs. ExPASy Swiss-Prot
Match: P26531 (ATP synthase subunit beta, chloroplastic OS=Nicotiana sp. OX=4094 GN=atpB PE=3 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 3.1e-29 Identity = 75/110 (68.18%), Postives = 79/110 (71.82%), Query Frame = 0
BLAST of MC08g0733 vs. ExPASy Swiss-Prot
Match: Q3V527 (ATP synthase subunit beta, chloroplastic OS=Acorus calamus OX=4465 GN=atpB PE=3 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 6.9e-29 Identity = 74/110 (67.27%), Postives = 79/110 (71.82%), Query Frame = 0
BLAST of MC08g0733 vs. ExPASy Swiss-Prot
Match: Q7HDI4 (ATP synthase subunit beta, chloroplastic OS=Acrocomia aculeata OX=169987 GN=atpB PE=3 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 6.9e-29 Identity = 74/110 (67.27%), Postives = 79/110 (71.82%), Query Frame = 0
BLAST of MC08g0733 vs. ExPASy Swiss-Prot
Match: Q70XZ6 (ATP synthase subunit beta, chloroplastic OS=Amborella trichopoda OX=13333 GN=atpB PE=3 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 6.9e-29 Identity = 74/110 (67.27%), Postives = 79/110 (71.82%), Query Frame = 0
BLAST of MC08g0733 vs. ExPASy Swiss-Prot
Match: Q9MRV8 (ATP synthase subunit beta, chloroplastic OS=Aristolochia macrophylla OX=12949 GN=atpB PE=3 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 6.9e-29 Identity = 74/110 (67.27%), Postives = 79/110 (71.82%), Query Frame = 0
BLAST of MC08g0733 vs. NCBI nr
Match: ANN24337.1 (ATP synthase beta subunit, partial [Crupina crupinastrum]) HSP 1 Score: 124 bits (312), Expect = 2.84e-34 Identity = 74/110 (67.27%), Postives = 79/110 (71.82%), Query Frame = 0
BLAST of MC08g0733 vs. NCBI nr
Match: ANN24338.1 (ATP synthase beta subunit, partial [Atractylis cancellata]) HSP 1 Score: 124 bits (312), Expect = 3.39e-34 Identity = 74/110 (67.27%), Postives = 79/110 (71.82%), Query Frame = 0
BLAST of MC08g0733 vs. NCBI nr
Match: ANN24376.1 (ATP synthase beta subunit, partial [Carthamus tenuis]) HSP 1 Score: 124 bits (312), Expect = 3.81e-34 Identity = 74/110 (67.27%), Postives = 79/110 (71.82%), Query Frame = 0
BLAST of MC08g0733 vs. NCBI nr
Match: ANN24363.1 (ATP synthase beta subunit, partial [Cynodon dactylon]) HSP 1 Score: 124 bits (312), Expect = 3.93e-34 Identity = 74/110 (67.27%), Postives = 79/110 (71.82%), Query Frame = 0
BLAST of MC08g0733 vs. NCBI nr
Match: ANN24355.1 (ATP synthase beta subunit, partial [Convolvulus betonicifolius]) HSP 1 Score: 124 bits (312), Expect = 3.93e-34 Identity = 74/110 (67.27%), Postives = 79/110 (71.82%), Query Frame = 0
BLAST of MC08g0733 vs. ExPASy TrEMBL
Match: A0A193CI48 (ATP synthase beta subunit (Fragment) OS=Crupina crupinastrum OX=41560 GN=atpB PE=3 SV=1) HSP 1 Score: 124 bits (312), Expect = 1.37e-34 Identity = 74/110 (67.27%), Postives = 79/110 (71.82%), Query Frame = 0
BLAST of MC08g0733 vs. ExPASy TrEMBL
Match: A0A193CI41 (ATP synthase beta subunit (Fragment) OS=Atractylis cancellata OX=143173 GN=atpB PE=3 SV=1) HSP 1 Score: 124 bits (312), Expect = 1.64e-34 Identity = 74/110 (67.27%), Postives = 79/110 (71.82%), Query Frame = 0
BLAST of MC08g0733 vs. ExPASy TrEMBL
Match: A0A193CI85 (H(+)-transporting two-sector ATPase (Fragment) OS=Carthamus tenuis OX=123802 GN=atpB PE=3 SV=1) HSP 1 Score: 124 bits (312), Expect = 1.85e-34 Identity = 74/110 (67.27%), Postives = 79/110 (71.82%), Query Frame = 0
BLAST of MC08g0733 vs. ExPASy TrEMBL
Match: A0A193CI52 (H(+)-transporting two-sector ATPase (Fragment) OS=Convolvulus betonicifolius OX=1428891 GN=atpB PE=3 SV=1) HSP 1 Score: 124 bits (312), Expect = 1.90e-34 Identity = 74/110 (67.27%), Postives = 79/110 (71.82%), Query Frame = 0
BLAST of MC08g0733 vs. ExPASy TrEMBL
Match: A0A193CI67 (H(+)-transporting two-sector ATPase (Fragment) OS=Cynodon dactylon OX=28909 GN=atpB PE=3 SV=1) HSP 1 Score: 124 bits (312), Expect = 1.90e-34 Identity = 74/110 (67.27%), Postives = 79/110 (71.82%), Query Frame = 0
BLAST of MC08g0733 vs. TAIR 10
Match: ATCG00480.1 (ATP synthase subunit beta ) HSP 1 Score: 125.2 bits (313), Expect = 3.2e-29 Identity = 72/110 (65.45%), Postives = 79/110 (71.82%), Query Frame = 0
BLAST of MC08g0733 vs. TAIR 10
Match: AT5G08670.1 (ATP synthase alpha/beta family protein ) HSP 1 Score: 107.1 bits (266), Expect = 8.9e-24 Identity = 60/110 (54.55%), Postives = 74/110 (67.27%), Query Frame = 0
BLAST of MC08g0733 vs. TAIR 10
Match: AT5G08680.1 (ATP synthase alpha/beta family protein ) HSP 1 Score: 107.1 bits (266), Expect = 8.9e-24 Identity = 60/110 (54.55%), Postives = 74/110 (67.27%), Query Frame = 0
BLAST of MC08g0733 vs. TAIR 10
Match: AT5G08690.1 (ATP synthase alpha/beta family protein ) HSP 1 Score: 107.1 bits (266), Expect = 8.9e-24 Identity = 60/110 (54.55%), Postives = 74/110 (67.27%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|