MC08g0103 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCCGAAGAAGAGTCCGGGGAGGCTATCCGTCCCGAAATTCCGACCGGACGAGTCAAGAAGATAATGAAGGTGGACAAGGACGTATGCAAAGTGAACTCTGAAGCACTATTTCTTGTCTCATGCGCCACCGATCTCTTCCTGAAGCTTCTCGCTGAAAAGTCTGCAGAAGTCGCCACGGAGAAGAAACGGAAGACAGTTAAGCTTGAACACATCCGAATCGCCGTCAAAAGGCATCGACCGATCAGTGATTTTCTCCTCGATTCGCTACCTCTTCCACCTCAGCCGTCGGATGCTCCGGCGAAGAACGAGAATCGCACCCGCACTGCCGCCGACAAAGCAGCTCCCGAGGGAACCCGTCGAATCGACGATTTCTTTCGCAAGCCAGCGAAGACAACGTCGGATGAGAACAACGAGTCG ATGGCCGAAGAAGAGTCCGGGGAGGCTATCCGTCCCGAAATTCCGACCGGACGAGTCAAGAAGATAATGAAGGTGGACAAGGACGTATGCAAAGTGAACTCTGAAGCACTATTTCTTGTCTCATGCGCCACCGATCTCTTCCTGAAGCTTCTCGCTGAAAAGTCTGCAGAAGTCGCCACGGAGAAGAAACGGAAGACAGTTAAGCTTGAACACATCCGAATCGCCGTCAAAAGGCATCGACCGATCAGTGATTTTCTCCTCGATTCGCTACCTCTTCCACCTCAGCCGTCGGATGCTCCGGCGAAGAACGAGAATCGCACCCGCACTGCCGCCGACAAAGCAGCTCCCGAGGGAACCCGTCGAATCGACGATTTCTTTCGCAAGCCAGCGAAGACAACGTCGGATGAGAACAACGAGTCG ATGGCCGAAGAAGAGTCCGGGGAGGCTATCCGTCCCGAAATTCCGACCGGACGAGTCAAGAAGATAATGAAGGTGGACAAGGACGTATGCAAAGTGAACTCTGAAGCACTATTTCTTGTCTCATGCGCCACCGATCTCTTCCTGAAGCTTCTCGCTGAAAAGTCTGCAGAAGTCGCCACGGAGAAGAAACGGAAGACAGTTAAGCTTGAACACATCCGAATCGCCGTCAAAAGGCATCGACCGATCAGTGATTTTCTCCTCGATTCGCTACCTCTTCCACCTCAGCCGTCGGATGCTCCGGCGAAGAACGAGAATCGCACCCGCACTGCCGCCGACAAAGCAGCTCCCGAGGGAACCCGTCGAATCGACGATTTCTTTCGCAAGCCAGCGAAGACAACGTCGGATGAGAACAACGAGTCG MAEEESGEAIRPEIPTGRVKKIMKVDKDVCKVNSEALFLVSCATDLFLKLLAEKSAEVATEKKRKTVKLEHIRIAVKRHRPISDFLLDSLPLPPQPSDAPAKNENRTRTAADKAAPEGTRRIDDFFRKPAKTTSDENNES Homology
BLAST of MC08g0103 vs. ExPASy Swiss-Prot
Match: Q9SMP0 (Nuclear transcription factor Y subunit C-1 OS=Arabidopsis thaliana OX=3702 GN=NFYC1 PE=1 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 8.3e-06 Identity = 32/79 (40.51%), Postives = 49/79 (62.03%), Query Frame = 0
BLAST of MC08g0103 vs. ExPASy Swiss-Prot
Match: Q9FMV5 (Nuclear transcription factor Y subunit C-4 OS=Arabidopsis thaliana OX=3702 GN=NFYC4 PE=1 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 8.3e-06 Identity = 32/79 (40.51%), Postives = 49/79 (62.03%), Query Frame = 0
BLAST of MC08g0103 vs. ExPASy Swiss-Prot
Match: A6BLW4 (Nuclear transcription factor Y subunit C-2 OS=Oryza sativa subsp. japonica OX=39947 GN=NFYC2 PE=1 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 1.9e-05 Identity = 30/79 (37.97%), Postives = 49/79 (62.03%), Query Frame = 0
BLAST of MC08g0103 vs. ExPASy Swiss-Prot
Match: Q9W256 (DNA polymerase epsilon subunit 4 OS=Drosophila melanogaster OX=7227 GN=Mes4 PE=2 SV=1) HSP 1 Score: 48.9 bits (115), Expect = 5.4e-05 Identity = 23/69 (33.33%), Postives = 44/69 (63.77%), Query Frame = 0
BLAST of MC08g0103 vs. ExPASy Swiss-Prot
Match: Q9ZVL3 (Nuclear transcription factor Y subunit C-3 OS=Arabidopsis thaliana OX=3702 GN=NFYC3 PE=1 SV=1) HSP 1 Score: 48.5 bits (114), Expect = 7.1e-05 Identity = 30/78 (38.46%), Postives = 47/78 (60.26%), Query Frame = 0
BLAST of MC08g0103 vs. NCBI nr
Match: XP_022132171.1 (nuclear transcription factor Y subunit C-1 [Momordica charantia]) HSP 1 Score: 266 bits (681), Expect = 1.13e-89 Identity = 140/140 (100.00%), Postives = 140/140 (100.00%), Query Frame = 0
BLAST of MC08g0103 vs. NCBI nr
Match: XP_038884228.1 (NCT transcriptional regulatory complex subunit A [Benincasa hispida]) HSP 1 Score: 238 bits (608), Expect = 1.53e-78 Identity = 125/140 (89.29%), Postives = 131/140 (93.57%), Query Frame = 0
BLAST of MC08g0103 vs. NCBI nr
Match: KAA0064731.1 (dr1-associated corepressor [Cucumis melo var. makuwa]) HSP 1 Score: 224 bits (571), Expect = 6.68e-73 Identity = 118/140 (84.29%), Postives = 125/140 (89.29%), Query Frame = 0
BLAST of MC08g0103 vs. NCBI nr
Match: XP_008445504.1 (PREDICTED: dr1-associated corepressor [Cucumis melo]) HSP 1 Score: 222 bits (565), Expect = 5.49e-72 Identity = 118/140 (84.29%), Postives = 124/140 (88.57%), Query Frame = 0
BLAST of MC08g0103 vs. NCBI nr
Match: XP_022997291.1 (DNA polymerase epsilon subunit C [Cucurbita maxima]) HSP 1 Score: 221 bits (564), Expect = 7.79e-72 Identity = 116/140 (82.86%), Postives = 125/140 (89.29%), Query Frame = 0
BLAST of MC08g0103 vs. ExPASy TrEMBL
Match: A0A6J1BRI3 (nuclear transcription factor Y subunit C-1 OS=Momordica charantia OX=3673 GN=LOC111005093 PE=4 SV=1) HSP 1 Score: 266 bits (681), Expect = 5.48e-90 Identity = 140/140 (100.00%), Postives = 140/140 (100.00%), Query Frame = 0
BLAST of MC08g0103 vs. ExPASy TrEMBL
Match: A0A5A7VG98 (Dr1-associated corepressor OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold82G00350 PE=4 SV=1) HSP 1 Score: 224 bits (571), Expect = 3.24e-73 Identity = 118/140 (84.29%), Postives = 125/140 (89.29%), Query Frame = 0
BLAST of MC08g0103 vs. ExPASy TrEMBL
Match: A0A1S3BDL4 (dr1-associated corepressor OS=Cucumis melo OX=3656 GN=LOC103488501 PE=4 SV=1) HSP 1 Score: 222 bits (565), Expect = 2.66e-72 Identity = 118/140 (84.29%), Postives = 124/140 (88.57%), Query Frame = 0
BLAST of MC08g0103 vs. ExPASy TrEMBL
Match: A0A6J1K737 (DNA polymerase epsilon subunit C OS=Cucurbita maxima OX=3661 GN=LOC111492238 PE=4 SV=1) HSP 1 Score: 221 bits (564), Expect = 3.77e-72 Identity = 116/140 (82.86%), Postives = 125/140 (89.29%), Query Frame = 0
BLAST of MC08g0103 vs. ExPASy TrEMBL
Match: A0A6J1HCT3 (DNA polymerase epsilon subunit C OS=Cucurbita moschata OX=3662 GN=LOC111462901 PE=4 SV=1) HSP 1 Score: 219 bits (557), Expect = 4.40e-71 Identity = 114/140 (81.43%), Postives = 124/140 (88.57%), Query Frame = 0
BLAST of MC08g0103 vs. TAIR 10
Match: AT5G43250.1 (nuclear factor Y, subunit C13 ) HSP 1 Score: 145.2 bits (365), Expect = 3.9e-35 Identity = 86/136 (63.24%), Postives = 101/136 (74.26%), Query Frame = 0
BLAST of MC08g0103 vs. TAIR 10
Match: AT3G48590.1 (nuclear factor Y, subunit C1 ) HSP 1 Score: 51.6 bits (122), Expect = 5.9e-07 Identity = 32/79 (40.51%), Postives = 49/79 (62.03%), Query Frame = 0
BLAST of MC08g0103 vs. TAIR 10
Match: AT5G63470.1 (nuclear factor Y, subunit C4 ) HSP 1 Score: 51.6 bits (122), Expect = 5.9e-07 Identity = 32/79 (40.51%), Postives = 49/79 (62.03%), Query Frame = 0
BLAST of MC08g0103 vs. TAIR 10
Match: AT5G63470.2 (nuclear factor Y, subunit C4 ) HSP 1 Score: 51.6 bits (122), Expect = 5.9e-07 Identity = 32/79 (40.51%), Postives = 49/79 (62.03%), Query Frame = 0
BLAST of MC08g0103 vs. TAIR 10
Match: AT1G08970.4 (nuclear factor Y, subunit C9 ) HSP 1 Score: 48.5 bits (114), Expect = 5.0e-06 Identity = 30/78 (38.46%), Postives = 47/78 (60.26%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|