MC08g0022 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGAAGCAACCGGTCCGGATGAAGGCTGTGGTCTACGCCTTATCGCCATTCCAGCAGAAGATCATGACAGGGTTATGGAACGACTTGACCGGCAAGATTCACCACAAGATCTCCGAGAACTGGATCAGTGCCGTCCTTCTAGTTACTCCCGTCGTCGGCACCTACACG ATGGGGAAGCAACCGGTCCGGATGAAGGCTGTGGTCTACGCCTTATCGCCATTCCAGCAGAAGATCATGACAGGGTTATGGAACGACTTGACCGGCAAGATTCACCACAAGATCTCCGAGAACTGGATCAGTGCCGTCCTTCTAGTTACTCCCGTCGTCGGCACCTACACG ATGGGGAAGCAACCGGTCCGGATGAAGGCTGTGGTCTACGCCTTATCGCCATTCCAGCAGAAGATCATGACAGGGTTATGGAACGACTTGACCGGCAAGATTCACCACAAGATCTCCGAGAACTGGATCAGTGCCGTCCTTCTAGTTACTCCCGTCGTCGGCACCTACACG MGKQPVRMKAVVYALSPFQQKIMTGLWNDLTGKIHHKISENWISAVLLVTPVVGTYT Homology
BLAST of MC08g0022 vs. ExPASy Swiss-Prot
Match: Q9SG91 (Cytochrome b-c1 complex subunit 8-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=UCRQ-1 PE=1 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 8.9e-23 Identity = 49/56 (87.50%), Postives = 52/56 (92.86%), Query Frame = 0
BLAST of MC08g0022 vs. ExPASy Swiss-Prot
Match: Q9FLB7 (Cytochrome b-c1 complex subunit 8-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=UCRQ-2 PE=1 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 4.4e-22 Identity = 47/57 (82.46%), Postives = 52/57 (91.23%), Query Frame = 0
BLAST of MC08g0022 vs. ExPASy Swiss-Prot
Match: P46269 (Cytochrome b-c1 complex subunit 8 OS=Solanum tuberosum OX=4113 PE=1 SV=2) HSP 1 Score: 101.7 bits (252), Expect = 2.9e-21 Identity = 45/57 (78.95%), Postives = 52/57 (91.23%), Query Frame = 0
BLAST of MC08g0022 vs. NCBI nr
Match: XP_022131282.1 (cytochrome b-c1 complex subunit 8-like [Momordica charantia]) HSP 1 Score: 120 bits (301), Expect = 3.97e-34 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 0
BLAST of MC08g0022 vs. NCBI nr
Match: XP_038886592.1 (cytochrome b-c1 complex subunit 8-like [Benincasa hispida]) HSP 1 Score: 115 bits (289), Expect = 2.69e-32 Identity = 53/57 (92.98%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of MC08g0022 vs. NCBI nr
Match: XP_022951208.1 (cytochrome b-c1 complex subunit 8-like [Cucurbita moschata] >XP_023002778.1 cytochrome b-c1 complex subunit 8-like [Cucurbita maxima] >XP_023537368.1 cytochrome b-c1 complex subunit 8-like [Cucurbita pepo subsp. pepo] >KAG6585163.1 Cytochrome b-c1 complex subunit 8-1, mitochondrial, partial [Cucurbita argyrosperma subsp. sororia] >KAG7020083.1 hypothetical protein SDJN02_16765 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 114 bits (286), Expect = 7.73e-32 Identity = 52/57 (91.23%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of MC08g0022 vs. NCBI nr
Match: XP_022961649.1 (cytochrome b-c1 complex subunit 8-like [Cucurbita moschata] >XP_022997627.1 cytochrome b-c1 complex subunit 8-like [Cucurbita maxima] >XP_023545652.1 cytochrome b-c1 complex subunit 8-like [Cucurbita pepo subsp. pepo] >KAG6598219.1 Cytochrome b-c1 complex subunit 8-1, mitochondrial, partial [Cucurbita argyrosperma subsp. sororia] >KAG7029201.1 hypothetical protein SDJN02_07538, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 114 bits (286), Expect = 7.73e-32 Identity = 52/57 (91.23%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of MC08g0022 vs. NCBI nr
Match: XP_004142978.1 (cytochrome b-c1 complex subunit 8 [Cucumis sativus]) HSP 1 Score: 114 bits (284), Expect = 1.56e-31 Identity = 52/57 (91.23%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of MC08g0022 vs. ExPASy TrEMBL
Match: A0A6J1BQK7 (cytochrome b-c1 complex subunit 8-like OS=Momordica charantia OX=3673 GN=LOC111004551 PE=3 SV=1) HSP 1 Score: 120 bits (301), Expect = 1.92e-34 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 0
BLAST of MC08g0022 vs. ExPASy TrEMBL
Match: A0A6J1K5M6 (cytochrome b-c1 complex subunit 8-like OS=Cucurbita maxima OX=3661 GN=LOC111492502 PE=3 SV=1) HSP 1 Score: 114 bits (286), Expect = 3.74e-32 Identity = 52/57 (91.23%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of MC08g0022 vs. ExPASy TrEMBL
Match: A0A6J1KUK4 (cytochrome b-c1 complex subunit 8-like OS=Cucurbita maxima OX=3661 GN=LOC111496537 PE=3 SV=1) HSP 1 Score: 114 bits (286), Expect = 3.74e-32 Identity = 52/57 (91.23%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of MC08g0022 vs. ExPASy TrEMBL
Match: A0A6J1HEN4 (cytochrome b-c1 complex subunit 8-like OS=Cucurbita moschata OX=3662 GN=LOC111462357 PE=3 SV=1) HSP 1 Score: 114 bits (286), Expect = 3.74e-32 Identity = 52/57 (91.23%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of MC08g0022 vs. ExPASy TrEMBL
Match: A0A6J1GH36 (cytochrome b-c1 complex subunit 8-like OS=Cucurbita moschata OX=3662 GN=LOC111454117 PE=3 SV=1) HSP 1 Score: 114 bits (286), Expect = 3.74e-32 Identity = 52/57 (91.23%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of MC08g0022 vs. TAIR 10
Match: AT3G10860.1 (Cytochrome b-c1 complex, subunit 8 protein ) HSP 1 Score: 106.7 bits (265), Expect = 6.3e-24 Identity = 49/56 (87.50%), Postives = 52/56 (92.86%), Query Frame = 0
BLAST of MC08g0022 vs. TAIR 10
Match: AT5G05370.1 (Cytochrome b-c1 complex, subunit 8 protein ) HSP 1 Score: 104.4 bits (259), Expect = 3.1e-23 Identity = 47/57 (82.46%), Postives = 52/57 (91.23%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|