MC07g0271 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TTGTGTTGCAATAATCATCCTAAATTGGGCACTTTCAAACCTGGAATAGATGACAGGCAAGACGATGGGAAGTGTTGGAGTTTTTGCATTTCTGGATGTAGAGGAGGTTTCTGCAAGCAAGTTGGCAATAAACATATTTGTCATTGCTATTGT TTGTGTTGCAATAATCATCCTAAATTGGGCACTTTCAAACCTGGAATAGATGACAGGCAAGACGATGGGAAGTGTTGGAGTTTTTGCATTTCTGGATGTAGAGGAGGTTTCTGCAAGCAAGTTGGCAATAAACATATTTGTCATTGCTATTGT TTGTGTTGCAATAATCATCCTAAATTGGGCACTTTCAAACCTGGAATAGATGACAGGCAAGACGATGGGAAGTGTTGGAGTTTTTGCATTTCTGGATGTAGAGGAGGTTTCTGCAAGCAAGTTGGCAATAAACATATTTGTCATTGCTATTGT LCCNNHPKLGTFKPGIDDRQDDGKCWSFCISGCRGGFCKQVGNKHICHCYC Homology
BLAST of MC07g0271 vs. ExPASy Swiss-Prot
Match: Q2V2S1 (Putative defensin-like protein 20 OS=Arabidopsis thaliana OX=3702 GN=At5g52605 PE=3 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 2.3e-14 Identity = 32/53 (60.38%), Postives = 36/53 (67.92%), Query Frame = 0
BLAST of MC07g0271 vs. ExPASy Swiss-Prot
Match: P0CAX9 (Defensin-like protein 21 OS=Arabidopsis thaliana OX=3702 GN=At4g14276 PE=2 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 8.8e-14 Identity = 31/53 (58.49%), Postives = 35/53 (66.04%), Query Frame = 0
BLAST of MC07g0271 vs. ExPASy Swiss-Prot
Match: Q2V391 (Defensin-like protein 22 OS=Arabidopsis thaliana OX=3702 GN=At5g08315 PE=2 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 2.9e-09 Identity = 25/54 (46.30%), Postives = 35/54 (64.81%), Query Frame = 0
BLAST of MC07g0271 vs. NCBI nr
Match: XP_019087725.1 (PREDICTED: putative defensin-like protein 20 [Camelina sativa]) HSP 1 Score: 92.4 bits (228), Expect = 6.58e-23 Identity = 36/53 (67.92%), Postives = 40/53 (75.47%), Query Frame = 0
BLAST of MC07g0271 vs. NCBI nr
Match: XP_010450072.1 (PREDICTED: putative defensin-like protein 20 [Camelina sativa] >XP_010450073.1 PREDICTED: putative defensin-like protein 20 [Camelina sativa] >XP_010497033.1 PREDICTED: putative defensin-like protein 20 [Camelina sativa]) HSP 1 Score: 92.0 bits (227), Expect = 1.04e-22 Identity = 36/53 (67.92%), Postives = 40/53 (75.47%), Query Frame = 0
BLAST of MC07g0271 vs. NCBI nr
Match: XP_006285438.1 (defensin-like protein 21 [Capsella rubella] >EOA18336.1 hypothetical protein CARUB_v10006855mg [Capsella rubella]) HSP 1 Score: 91.3 bits (225), Expect = 2.29e-22 Identity = 36/53 (67.92%), Postives = 39/53 (73.58%), Query Frame = 0
BLAST of MC07g0271 vs. NCBI nr
Match: TYK10191.1 (putative defensin-like protein 20 [Cucumis melo var. makuwa]) HSP 1 Score: 91.7 bits (226), Expect = 4.32e-22 Identity = 35/52 (67.31%), Postives = 44/52 (84.62%), Query Frame = 0
BLAST of MC07g0271 vs. NCBI nr
Match: TYK10190.1 (putative defensin-like protein 20 [Cucumis melo var. makuwa]) HSP 1 Score: 89.0 bits (219), Expect = 1.21e-21 Identity = 34/52 (65.38%), Postives = 44/52 (84.62%), Query Frame = 0
BLAST of MC07g0271 vs. ExPASy TrEMBL
Match: R0F9I9 (Uncharacterized protein OS=Capsella rubella OX=81985 GN=CARUB_v10006855mg PE=3 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 1.11e-22 Identity = 36/53 (67.92%), Postives = 39/53 (73.58%), Query Frame = 0
BLAST of MC07g0271 vs. ExPASy TrEMBL
Match: A0A5D3CEJ1 (Putative defensin-like protein 20 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold16G003360 PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 2.09e-22 Identity = 35/52 (67.31%), Postives = 44/52 (84.62%), Query Frame = 0
BLAST of MC07g0271 vs. ExPASy TrEMBL
Match: A0A5D3CFQ3 (Putative defensin-like protein 20 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold16G003350 PE=3 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 5.86e-22 Identity = 34/52 (65.38%), Postives = 44/52 (84.62%), Query Frame = 0
BLAST of MC07g0271 vs. ExPASy TrEMBL
Match: R0H1Y0 (Uncharacterized protein OS=Capsella rubella OX=81985 GN=CARUB_v10007236mg PE=3 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 5.11e-21 Identity = 35/53 (66.04%), Postives = 37/53 (69.81%), Query Frame = 0
BLAST of MC07g0271 vs. ExPASy TrEMBL
Match: D7MH45 (Uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata OX=81972 GN=ARALYDRAFT_915457 PE=3 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 1.39e-20 Identity = 33/53 (62.26%), Postives = 39/53 (73.58%), Query Frame = 0
BLAST of MC07g0271 vs. TAIR 10
Match: AT5G52605.1 (Defensin-like (DEFL) family protein ) HSP 1 Score: 78.6 bits (192), Expect = 1.7e-15 Identity = 32/53 (60.38%), Postives = 36/53 (67.92%), Query Frame = 0
BLAST of MC07g0271 vs. TAIR 10
Match: AT4G14276.1 (Defensin-like (DEFL) family protein ) HSP 1 Score: 76.6 bits (187), Expect = 6.3e-15 Identity = 31/53 (58.49%), Postives = 35/53 (66.04%), Query Frame = 0
BLAST of MC07g0271 vs. TAIR 10
Match: AT5G08315.1 (Defensin-like (DEFL) family protein ) HSP 1 Score: 61.6 bits (148), Expect = 2.1e-10 Identity = 25/54 (46.30%), Postives = 35/54 (64.81%), Query Frame = 0
BLAST of MC07g0271 vs. TAIR 10
Match: AT4G14272.1 (Defensin-like (DEFL) family protein ) HSP 1 Score: 40.0 bits (92), Expect = 6.5e-04 Identity = 17/43 (39.53%), Postives = 22/43 (51.16%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|