MC06g2271 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TTCGTGGATGATCAGTTTTCCCAACTTAAGCAACTGCAGGACGAGAGTAGTCCAAATTTTGTGATTGAGGTTGTCTACCTCTTCTTTGATGATTCACAGAAGCTTATAGATGAAATGGGCAGAGCCCTGTGAGTGCTTGTGTTTCCTTAAGCGCCTTTTGTATATTTTCCCAATTCCCAGTAGTTGGGCAAATTTTGGAAAAGCTTTACTTGTTCTGTGTTTTGGTTCTCCATACTATGTATTGCAGGAGAAGTTGGCATCTTCAGGGTAGGAAGAACTAATTAATTGGATTTTTGCCTTTTGGTGTTGTAGGGAGCAGAACAGTGTGGATTTCAAACAGGTAGATGACAATGTACATCAACTCAAGGGTAGCAGCGCA TTCGTGGATGATCAGTTTTCCCAACTTAAGCAACTGCAGGACGAGAGTAGTCCAAATTTTGTGATTGAGGTTGTCTACCTCTTCTTTGATGATTCACAGAAGCTTATAGATGAAATGGGCAGAGCCCTGGAGCAGAACAGTGTGGATTTCAAACAGGTAGATGACAATGTACATCAACTCAAGGGTAGCAGCGCA TTCGTGGATGATCAGTTTTCCCAACTTAAGCAACTGCAGGACGAGAGTAGTCCAAATTTTGTGATTGAGGTTGTCTACCTCTTCTTTGATGATTCACAGAAGCTTATAGATGAAATGGGCAGAGCCCTGGAGCAGAACAGTGTGGATTTCAAACAGGTAGATGACAATGTACATCAACTCAAGGGTAGCAGCGCA FVDDQFSQLKQLQDESSPNFVIEVVYLFFDDSQKLIDEMGRALEQNSVDFKQVDDNVHQLKGSSA Homology
BLAST of MC06g2271 vs. ExPASy Swiss-Prot
Match: Q9SAZ5 (Histidine-containing phosphotransfer protein 3 OS=Arabidopsis thaliana OX=3702 GN=AHP3 PE=1 SV=2) HSP 1 Score: 84.3 bits (207), Expect = 5.4e-16 Identity = 43/66 (65.15%), Postives = 54/66 (81.82%), Query Frame = 0
BLAST of MC06g2271 vs. ExPASy Swiss-Prot
Match: Q8L9T7 (Histidine-containing phosphotransfer protein 5 OS=Arabidopsis thaliana OX=3702 GN=AHP5 PE=1 SV=2) HSP 1 Score: 83.2 bits (204), Expect = 1.2e-15 Identity = 42/66 (63.64%), Postives = 55/66 (83.33%), Query Frame = 0
BLAST of MC06g2271 vs. ExPASy Swiss-Prot
Match: Q9ZNV9 (Histidine-containing phosphotransfer protein 1 OS=Arabidopsis thaliana OX=3702 GN=AHP1 PE=1 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 1.3e-14 Identity = 37/64 (57.81%), Postives = 53/64 (82.81%), Query Frame = 0
BLAST of MC06g2271 vs. ExPASy Swiss-Prot
Match: Q9ZNV8 (Histidine-containing phosphotransfer protein 2 OS=Arabidopsis thaliana OX=3702 GN=AHP2 PE=1 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 3.9e-14 Identity = 40/66 (60.61%), Postives = 52/66 (78.79%), Query Frame = 0
BLAST of MC06g2271 vs. ExPASy Swiss-Prot
Match: Q6VAK3 (Histidine-containing phosphotransfer protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=AHP1 PE=2 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 5.0e-14 Identity = 38/64 (59.38%), Postives = 50/64 (78.12%), Query Frame = 0
BLAST of MC06g2271 vs. NCBI nr
Match: XP_022155600.1 (histidine-containing phosphotransfer protein 5-like isoform X3 [Momordica charantia]) HSP 1 Score: 130 bits (326), Expect = 5.86e-37 Identity = 65/65 (100.00%), Postives = 65/65 (100.00%), Query Frame = 0
BLAST of MC06g2271 vs. NCBI nr
Match: XP_022155599.1 (histidine-containing phosphotransfer protein 5-like isoform X2 [Momordica charantia]) HSP 1 Score: 130 bits (326), Expect = 8.87e-37 Identity = 65/65 (100.00%), Postives = 65/65 (100.00%), Query Frame = 0
BLAST of MC06g2271 vs. NCBI nr
Match: XP_022155598.1 (histidine-containing phosphotransfer protein 1-like isoform X1 [Momordica charantia]) HSP 1 Score: 130 bits (326), Expect = 1.09e-36 Identity = 65/65 (100.00%), Postives = 65/65 (100.00%), Query Frame = 0
BLAST of MC06g2271 vs. NCBI nr
Match: XP_021820126.1 (histidine-containing phosphotransfer protein 1-like [Prunus avium]) HSP 1 Score: 100 bits (249), Expect = 4.47e-25 Identity = 49/65 (75.38%), Postives = 58/65 (89.23%), Query Frame = 0
BLAST of MC06g2271 vs. NCBI nr
Match: XP_020409428.1 (histidine-containing phosphotransfer protein 1 [Prunus persica] >XP_034226819.1 histidine-containing phosphotransfer protein 1-like [Prunus dulcis] >ONH93725.1 hypothetical protein PRUPE_8G249400 [Prunus persica] >ONH93726.1 hypothetical protein PRUPE_8G249400 [Prunus persica] >VVA14065.1 PREDICTED: histidine-containing [Prunus dulcis]) HSP 1 Score: 100 bits (249), Expect = 4.47e-25 Identity = 49/65 (75.38%), Postives = 58/65 (89.23%), Query Frame = 0
BLAST of MC06g2271 vs. ExPASy TrEMBL
Match: A0A6J1DMV8 (histidine-containing phosphotransfer protein 5-like isoform X3 OS=Momordica charantia OX=3673 GN=LOC111022693 PE=4 SV=1) HSP 1 Score: 130 bits (326), Expect = 2.83e-37 Identity = 65/65 (100.00%), Postives = 65/65 (100.00%), Query Frame = 0
BLAST of MC06g2271 vs. ExPASy TrEMBL
Match: A0A6J1DQR4 (histidine-containing phosphotransfer protein 5-like isoform X2 OS=Momordica charantia OX=3673 GN=LOC111022693 PE=4 SV=1) HSP 1 Score: 130 bits (326), Expect = 4.30e-37 Identity = 65/65 (100.00%), Postives = 65/65 (100.00%), Query Frame = 0
BLAST of MC06g2271 vs. ExPASy TrEMBL
Match: A0A6J1DNE0 (histidine-containing phosphotransfer protein 1-like isoform X1 OS=Momordica charantia OX=3673 GN=LOC111022693 PE=4 SV=1) HSP 1 Score: 130 bits (326), Expect = 5.28e-37 Identity = 65/65 (100.00%), Postives = 65/65 (100.00%), Query Frame = 0
BLAST of MC06g2271 vs. ExPASy TrEMBL
Match: A0A251N307 (HPt domain-containing protein OS=Prunus persica OX=3760 GN=PRUPE_8G249400 PE=4 SV=1) HSP 1 Score: 100 bits (249), Expect = 2.16e-25 Identity = 49/65 (75.38%), Postives = 58/65 (89.23%), Query Frame = 0
BLAST of MC06g2271 vs. ExPASy TrEMBL
Match: A0A5E4EED4 (PREDICTED: histidine-containing OS=Prunus dulcis OX=3755 GN=ALMOND_2B001536 PE=4 SV=1) HSP 1 Score: 100 bits (249), Expect = 2.16e-25 Identity = 49/65 (75.38%), Postives = 58/65 (89.23%), Query Frame = 0
BLAST of MC06g2271 vs. TAIR 10
Match: AT5G39340.1 (histidine-containing phosphotransmitter 3 ) HSP 1 Score: 84.3 bits (207), Expect = 3.8e-17 Identity = 43/66 (65.15%), Postives = 54/66 (81.82%), Query Frame = 0
BLAST of MC06g2271 vs. TAIR 10
Match: AT1G03430.1 (histidine-containing phosphotransfer factor 5 ) HSP 1 Score: 83.2 bits (204), Expect = 8.5e-17 Identity = 42/66 (63.64%), Postives = 55/66 (83.33%), Query Frame = 0
BLAST of MC06g2271 vs. TAIR 10
Match: AT3G21510.1 (histidine-containing phosphotransmitter 1 ) HSP 1 Score: 79.7 bits (195), Expect = 9.4e-16 Identity = 37/64 (57.81%), Postives = 53/64 (82.81%), Query Frame = 0
BLAST of MC06g2271 vs. TAIR 10
Match: AT3G29350.1 (histidine-containing phosphotransmitter 2 ) HSP 1 Score: 78.2 bits (191), Expect = 2.7e-15 Identity = 40/66 (60.61%), Postives = 52/66 (78.79%), Query Frame = 0
BLAST of MC06g2271 vs. TAIR 10
Match: AT3G29350.2 (histidine-containing phosphotransmitter 2 ) HSP 1 Score: 78.2 bits (191), Expect = 2.7e-15 Identity = 40/66 (60.61%), Postives = 52/66 (78.79%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|