MC06g1926 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TTCAAATGCAAAACGTGCGACAAGTCATTTAGGTCGTATCAAGCATTGGGAGGGCACAAGGCGAGCCACAGCAAGATTAGAACAGAAGATTGTGTTCATCAGAAAGTTTTTCAATGTCTATTTTGCCCCAAAGTGTTTGAATCTGGACAGGCACTTGGAGGGCACAAGAAGGTCCATTTCTTCAAGAAAATTTCTCCTAAAAAATTTGGTAAAAACTCCATTGATCTCAACCGTCCACCTCCTGCTTATGATTATGATGAAGATGATGAAGATGAAGTTTCTGAAATTGAATTCTCTGCAATCTCCAAT TTCAAATGCAAAACGTGCGACAAGTCATTTAGGTCGTATCAAGCATTGGGAGGGCACAAGGCGAGCCACAGCAAGATTAGAACAGAAGATTGTGTTCATCAGAAAGTTTTTCAATGTCTATTTTGCCCCAAAGTGTTTGAATCTGGACAGGCACTTGGAGGGCACAAGAAGGTCCATTTCTTCAAGAAAATTTCTCCTAAAAAATTTGGTAAAAACTCCATTGATCTCAACCGTCCACCTCCTGCTTATGATTATGATGAAGATGATGAAGATGAAGTTTCTGAAATTGAATTCTCTGCAATCTCCAAT TTCAAATGCAAAACGTGCGACAAGTCATTTAGGTCGTATCAAGCATTGGGAGGGCACAAGGCGAGCCACAGCAAGATTAGAACAGAAGATTGTGTTCATCAGAAAGTTTTTCAATGTCTATTTTGCCCCAAAGTGTTTGAATCTGGACAGGCACTTGGAGGGCACAAGAAGGTCCATTTCTTCAAGAAAATTTCTCCTAAAAAATTTGGTAAAAACTCCATTGATCTCAACCGTCCACCTCCTGCTTATGATTATGATGAAGATGATGAAGATGAAGTTTCTGAAATTGAATTCTCTGCAATCTCCAAT FKCKTCDKSFRSYQALGGHKASHSKIRTEDCVHQKVFQCLFCPKVFESGQALGGHKKVHFFKKISPKKFGKNSIDLNRPPPAYDYDEDDEDEVSEIEFSAISN Homology
BLAST of MC06g1926 vs. ExPASy Swiss-Prot
Match: Q9M202 (Zinc finger protein ZAT9 OS=Arabidopsis thaliana OX=3702 GN=ZAT9 PE=2 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 8.0e-14 Identity = 47/120 (39.17%), Postives = 64/120 (53.33%), Query Frame = 0
BLAST of MC06g1926 vs. ExPASy Swiss-Prot
Match: Q9SHD0 (Zinc finger protein ZAT4 OS=Arabidopsis thaliana OX=3702 GN=ZAT4 PE=2 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 2.0e-12 Identity = 49/124 (39.52%), Postives = 64/124 (51.61%), Query Frame = 0
BLAST of MC06g1926 vs. ExPASy Swiss-Prot
Match: Q39092 (Zinc finger protein ZAT1 OS=Arabidopsis thaliana OX=3702 GN=ZAT1 PE=2 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 5.7e-12 Identity = 45/117 (38.46%), Postives = 65/117 (55.56%), Query Frame = 0
BLAST of MC06g1926 vs. ExPASy Swiss-Prot
Match: Q96289 (Zinc finger protein ZAT10 OS=Arabidopsis thaliana OX=3702 GN=ZAT10 PE=2 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 3.1e-10 Identity = 36/80 (45.00%), Postives = 40/80 (50.00%), Query Frame = 0
BLAST of MC06g1926 vs. ExPASy Swiss-Prot
Match: Q9LFG0 (Zinc finger protein ZAT18 OS=Arabidopsis thaliana OX=3702 GN=ZAT18 PE=2 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 3.1e-10 Identity = 30/67 (44.78%), Postives = 43/67 (64.18%), Query Frame = 0
BLAST of MC06g1926 vs. NCBI nr
Match: XP_022158577.1 (zinc finger protein ZAT1-like [Momordica charantia]) HSP 1 Score: 220 bits (560), Expect = 1.72e-70 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of MC06g1926 vs. NCBI nr
Match: KAB1210878.1 (Zinc finger protein ZAT9 [Morella rubra]) HSP 1 Score: 116 bits (291), Expect = 3.99e-29 Identity = 64/125 (51.20%), Postives = 77/125 (61.60%), Query Frame = 0
BLAST of MC06g1926 vs. NCBI nr
Match: KAE8022344.1 (hypothetical protein FH972_008149 [Carpinus fangiana]) HSP 1 Score: 108 bits (269), Expect = 5.56e-26 Identity = 59/121 (48.76%), Postives = 74/121 (61.16%), Query Frame = 0
BLAST of MC06g1926 vs. NCBI nr
Match: KAF5935731.1 (hypothetical protein HYC85_026860 [Camellia sinensis]) HSP 1 Score: 106 bits (265), Expect = 2.01e-25 Identity = 54/110 (49.09%), Postives = 74/110 (67.27%), Query Frame = 0
BLAST of MC06g1926 vs. NCBI nr
Match: XP_028063607.1 (zinc finger protein ZAT1-like [Camellia sinensis] >THG16955.1 hypothetical protein TEA_006400 [Camellia sinensis var. sinensis]) HSP 1 Score: 104 bits (260), Expect = 1.12e-24 Identity = 55/111 (49.55%), Postives = 75/111 (67.57%), Query Frame = 0
BLAST of MC06g1926 vs. ExPASy TrEMBL
Match: A0A6J1DXK2 (zinc finger protein ZAT1-like OS=Momordica charantia OX=3673 GN=LOC111025030 PE=4 SV=1) HSP 1 Score: 220 bits (560), Expect = 8.30e-71 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of MC06g1926 vs. ExPASy TrEMBL
Match: A0A6A1VGE4 (Zinc finger protein ZAT9 OS=Morella rubra OX=262757 GN=CJ030_MR6G019731 PE=4 SV=1) HSP 1 Score: 116 bits (291), Expect = 1.93e-29 Identity = 64/125 (51.20%), Postives = 77/125 (61.60%), Query Frame = 0
BLAST of MC06g1926 vs. ExPASy TrEMBL
Match: A0A5N6R157 (Uncharacterized protein OS=Carpinus fangiana OX=176857 GN=FH972_008149 PE=4 SV=1) HSP 1 Score: 108 bits (269), Expect = 2.69e-26 Identity = 59/121 (48.76%), Postives = 74/121 (61.16%), Query Frame = 0
BLAST of MC06g1926 vs. ExPASy TrEMBL
Match: A0A7J7G712 (Uncharacterized protein OS=Camellia sinensis OX=4442 GN=HYC85_026860 PE=4 SV=1) HSP 1 Score: 106 bits (265), Expect = 9.74e-26 Identity = 54/110 (49.09%), Postives = 74/110 (67.27%), Query Frame = 0
BLAST of MC06g1926 vs. ExPASy TrEMBL
Match: A0A4S4ELG9 (Uncharacterized protein OS=Camellia sinensis var. sinensis OX=542762 GN=TEA_006400 PE=4 SV=1) HSP 1 Score: 104 bits (260), Expect = 5.43e-25 Identity = 55/111 (49.55%), Postives = 75/111 (67.57%), Query Frame = 0
BLAST of MC06g1926 vs. TAIR 10
Match: AT3G60580.1 (C2H2-like zinc finger protein ) HSP 1 Score: 77.8 bits (190), Expect = 5.7e-15 Identity = 47/120 (39.17%), Postives = 64/120 (53.33%), Query Frame = 0
BLAST of MC06g1926 vs. TAIR 10
Match: AT2G45120.1 (C2H2-like zinc finger protein ) HSP 1 Score: 73.2 bits (178), Expect = 1.4e-13 Identity = 49/124 (39.52%), Postives = 64/124 (51.61%), Query Frame = 0
BLAST of MC06g1926 vs. TAIR 10
Match: AT1G02030.1 (C2H2-like zinc finger protein ) HSP 1 Score: 71.6 bits (174), Expect = 4.1e-13 Identity = 45/117 (38.46%), Postives = 65/117 (55.56%), Query Frame = 0
BLAST of MC06g1926 vs. TAIR 10
Match: AT5G61470.1 (C2H2-like zinc finger protein ) HSP 1 Score: 67.4 bits (163), Expect = 7.7e-12 Identity = 30/70 (42.86%), Postives = 42/70 (60.00%), Query Frame = 0
BLAST of MC06g1926 vs. TAIR 10
Match: AT1G27730.1 (salt tolerance zinc finger ) HSP 1 Score: 65.9 bits (159), Expect = 2.2e-11 Identity = 36/80 (45.00%), Postives = 40/80 (50.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|