MC06g1196 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TTATTAGAAATTCGAATTACCAACTTTTACACGAATTTTAAAGTGGATGAGATTGGTCGAGTGGTCTCAGTTGGAGATGGGATTGCACATGTTTATGGATTGAAGGCGATTCAAGCTTGGGAAATGGTGGAATTTGCT TTATTAGAAATTCGAATTACCAACTTTTACACGAATTTTAAAGTGGATGAGATTGGTCGAGTGGTCTCAGTTGGAGATGGGATTGCACATGTTTATGGATTGAAGGCGATTCAAGCTTGGGAAATGGTGGAATTTGCT TTATTAGAAATTCGAATTACCAACTTTTACACGAATTTTAAAGTGGATGAGATTGGTCGAGTGGTCTCAGTTGGAGATGGGATTGCACATGTTTATGGATTGAAGGCGATTCAAGCTTGGGAAATGGTGGAATTTGCT LLEIRITNFYTNFKVDEIGRVVSVGDGIAHVYGLKAIQAWEMVEFA Homology
BLAST of MC06g1196 vs. ExPASy Swiss-Prot
Match: Q06735 (ATP synthase subunit alpha, mitochondrial OS=Beta vulgaris OX=161934 GN=ATPA PE=3 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 7.2e-15 Identity = 40/46 (86.96%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MC06g1196 vs. ExPASy Swiss-Prot
Match: Q01915 (ATP synthase subunit alpha, mitochondrial OS=Glycine max OX=3847 GN=ATPA PE=3 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 7.2e-15 Identity = 40/46 (86.96%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MC06g1196 vs. ExPASy Swiss-Prot
Match: P05492 (ATP synthase subunit alpha, mitochondrial OS=Oenothera biennis OX=3942 GN=ATPA PE=3 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 9.4e-15 Identity = 39/46 (84.78%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MC06g1196 vs. ExPASy Swiss-Prot
Match: P0C520 (ATP synthase subunit alpha, mitochondrial OS=Oryza sativa OX=4530 GN=ATPA PE=3 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 1.6e-14 Identity = 39/46 (84.78%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MC06g1196 vs. ExPASy Swiss-Prot
Match: P0C521 (ATP synthase subunit alpha, mitochondrial OS=Oryza sativa subsp. indica OX=39946 GN=ATPA PE=3 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 1.6e-14 Identity = 39/46 (84.78%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MC06g1196 vs. NCBI nr
Match: PPR86452.1 (hypothetical protein GOBAR_AA34236 [Gossypium barbadense]) HSP 1 Score: 82.4 bits (202), Expect = 6.72e-19 Identity = 41/46 (89.13%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MC06g1196 vs. NCBI nr
Match: TYH25400.1 (hypothetical protein ES288_A03G165500v1 [Gossypium darwinii]) HSP 1 Score: 82.4 bits (202), Expect = 7.09e-19 Identity = 41/46 (89.13%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MC06g1196 vs. NCBI nr
Match: QHO38485.1 (ATP synthase subunit alpha [Arachis hypogaea]) HSP 1 Score: 82.8 bits (203), Expect = 1.35e-18 Identity = 41/46 (89.13%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of MC06g1196 vs. NCBI nr
Match: KCW45798.1 (hypothetical protein EUGRSUZ_L00375 [Eucalyptus grandis]) HSP 1 Score: 80.9 bits (198), Expect = 5.00e-18 Identity = 39/46 (84.78%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MC06g1196 vs. NCBI nr
Match: KAE9605142.1 (ATP synthase subunit alpha [Lupinus albus] >KAF1889126.1 hypothetical protein Lal_00035314 [Lupinus albus]) HSP 1 Score: 80.1 bits (196), Expect = 5.08e-18 Identity = 40/46 (86.96%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MC06g1196 vs. ExPASy TrEMBL
Match: A0A2P5W5S6 (ATP-synt_ab_N domain-containing protein OS=Gossypium barbadense OX=3634 GN=GOBAR_AA34236 PE=3 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 3.25e-19 Identity = 41/46 (89.13%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MC06g1196 vs. ExPASy TrEMBL
Match: A0A5D2H660 (ATP-synt_ab_N domain-containing protein OS=Gossypium darwinii OX=34276 GN=ES288_A03G165500v1 PE=3 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 3.43e-19 Identity = 41/46 (89.13%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MC06g1196 vs. ExPASy TrEMBL
Match: A0A803MJA2 (Uncharacterized protein OS=Chenopodium quinoa OX=63459 PE=4 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 1.01e-18 Identity = 40/46 (86.96%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MC06g1196 vs. ExPASy TrEMBL
Match: A0A803NCT7 (Uncharacterized protein OS=Chenopodium quinoa OX=63459 PE=4 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 2.36e-18 Identity = 40/46 (86.96%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MC06g1196 vs. ExPASy TrEMBL
Match: A0A058ZVF9 (ATP-synt_ab_N domain-containing protein OS=Eucalyptus grandis OX=71139 GN=EUGRSUZ_L00375 PE=3 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 2.42e-18 Identity = 39/46 (84.78%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MC06g1196 vs. TAIR 10
Match: AT2G07698.1 (ATPase, F1 complex, alpha subunit protein ) HSP 1 Score: 71.2 bits (173), Expect = 2.4e-13 Identity = 36/46 (78.26%), Postives = 37/46 (80.43%), Query Frame = 0
BLAST of MC06g1196 vs. TAIR 10
Match: ATMG01190.1 (ATP synthase subunit 1 ) HSP 1 Score: 71.2 bits (173), Expect = 2.4e-13 Identity = 36/46 (78.26%), Postives = 37/46 (80.43%), Query Frame = 0
BLAST of MC06g1196 vs. TAIR 10
Match: ATCG00120.1 (ATP synthase subunit alpha ) HSP 1 Score: 40.4 bits (93), Expect = 4.5e-04 Identity = 18/45 (40.00%), Postives = 26/45 (57.78%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|