
MC06g0442 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.AAACACAGCCAACTGAACCTGGAGCTGGTTCTAGAACCCTCTTCATATTCATATTCCTCGTCGTCTGCCGTTGATCATGTGATTGGGAGCACTCCAAATTGTGATGATGATCAGGCGAGGGTGTTCTCATGCAACTATTGCAAGAGAAAATTTTACAGCTCGCAGGCGTTGGGTGGCCACCAAAATGCGCATAAGCTGGAGAGGACTCTAGCCAAGAAGAGCAGAGAGATTAGAGGAGGAGCATACGCTGGAGATGAGAGCTGCAACATGAACATGAACATGATGATGAACAATTCGAACCATCTTTGGAAAATTGAGACG AAACACAGCCAACTGAACCTGGAGCTGGTTCTAGAACCCTCTTCATATTCATATTCCTCGTCGTCTGCCGTTGATCATGTGATTGGGAGCACTCCAAATTGTGATGATGATCAGGCGAGGGTGTTCTCATGCAACTATTGCAAGAGAAAATTTTACAGCTCGCAGGCGTTGGGTGGCCACCAAAATGCGCATAAGCTGGAGAGGACTCTAGCCAAGAAGAGCAGAGAGATTAGAGGAGGAGCATACGCTGGAGATGAGAGCTGCAACATGAACATGAACATGATGATGAACAATTCGAACCATCTTTGGAAAATTGAGACG AAACACAGCCAACTGAACCTGGAGCTGGTTCTAGAACCCTCTTCATATTCATATTCCTCGTCGTCTGCCGTTGATCATGTGATTGGGAGCACTCCAAATTGTGATGATGATCAGGCGAGGGTGTTCTCATGCAACTATTGCAAGAGAAAATTTTACAGCTCGCAGGCGTTGGGTGGCCACCAAAATGCGCATAAGCTGGAGAGGACTCTAGCCAAGAAGAGCAGAGAGATTAGAGGAGGAGCATACGCTGGAGATGAGAGCTGCAACATGAACATGAACATGATGATGAACAATTCGAACCATCTTTGGAAAATTGAGACG KHSQLNLELVLEPSSYSYSSSSAVDHVIGSTPNCDDDQARVFSCNYCKRKFYSSQALGGHQNAHKLERTLAKKSREIRGGAYAGDESCNMNMNMMMNNSNHLWKIET Homology
BLAST of MC06g0442 vs. ExPASy Swiss-Prot
Match: Q39261 (Zinc finger protein 2 OS=Arabidopsis thaliana OX=3702 GN=ZFP2 PE=1 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 4.1e-21 Identity = 56/77 (72.73%), Postives = 64/77 (83.12%), Query Frame = 0
BLAST of MC06g0442 vs. ExPASy Swiss-Prot
Match: Q42485 (Zinc finger protein 1 OS=Arabidopsis thaliana OX=3702 GN=ZFP1 PE=2 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 1.3e-11 Identity = 42/73 (57.53%), Postives = 47/73 (64.38%), Query Frame = 0
BLAST of MC06g0442 vs. ExPASy Swiss-Prot
Match: Q39263 (Zinc finger protein 4 OS=Arabidopsis thaliana OX=3702 GN=ZFP4 PE=2 SV=2) HSP 1 Score: 70.5 bits (171), Expect = 1.3e-11 Identity = 42/74 (56.76%), Postives = 47/74 (63.51%), Query Frame = 0
BLAST of MC06g0442 vs. ExPASy Swiss-Prot
Match: Q39266 (Zinc finger protein 7 OS=Arabidopsis thaliana OX=3702 GN=ZFP7 PE=1 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 1.7e-11 Identity = 30/35 (85.71%), Postives = 34/35 (97.14%), Query Frame = 0
BLAST of MC06g0442 vs. ExPASy Swiss-Prot
Match: Q39262 (Zinc finger protein 3 OS=Arabidopsis thaliana OX=3702 GN=ZFP3 PE=1 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 5.0e-11 Identity = 30/46 (65.22%), Postives = 37/46 (80.43%), Query Frame = 0
BLAST of MC06g0442 vs. NCBI nr
Match: XP_022134801.1 (protein LATE FLOWERING [Momordica charantia]) HSP 1 Score: 220 bits (560), Expect = 1.15e-71 Identity = 107/107 (100.00%), Postives = 107/107 (100.00%), Query Frame = 0
BLAST of MC06g0442 vs. NCBI nr
Match: XP_038880343.1 (zinc finger protein 3 [Benincasa hispida]) HSP 1 Score: 124 bits (312), Expect = 6.23e-34 Identity = 71/107 (66.36%), Postives = 81/107 (75.70%), Query Frame = 0
BLAST of MC06g0442 vs. NCBI nr
Match: XP_022987492.1 (zinc finger protein 7-like [Cucurbita maxima]) HSP 1 Score: 123 bits (309), Expect = 1.41e-33 Identity = 74/106 (69.81%), Postives = 81/106 (76.42%), Query Frame = 0
BLAST of MC06g0442 vs. NCBI nr
Match: XP_022921390.1 (zinc finger protein 7 [Cucurbita moschata]) HSP 1 Score: 123 bits (309), Expect = 1.41e-33 Identity = 74/106 (69.81%), Postives = 81/106 (76.42%), Query Frame = 0
BLAST of MC06g0442 vs. NCBI nr
Match: KAG6589714.1 (Zinc finger protein 2, partial [Cucurbita argyrosperma subsp. sororia] >KAG7023394.1 Zinc finger protein 2, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 123 bits (309), Expect = 1.41e-33 Identity = 74/106 (69.81%), Postives = 81/106 (76.42%), Query Frame = 0
BLAST of MC06g0442 vs. ExPASy TrEMBL
Match: A0A6J1BYT1 (protein LATE FLOWERING OS=Momordica charantia OX=3673 GN=LOC111006983 PE=4 SV=1) HSP 1 Score: 220 bits (560), Expect = 5.55e-72 Identity = 107/107 (100.00%), Postives = 107/107 (100.00%), Query Frame = 0
BLAST of MC06g0442 vs. ExPASy TrEMBL
Match: A0A6J1JAI3 (zinc finger protein 7-like OS=Cucurbita maxima OX=3661 GN=LOC111485036 PE=4 SV=1) HSP 1 Score: 123 bits (309), Expect = 6.81e-34 Identity = 74/106 (69.81%), Postives = 81/106 (76.42%), Query Frame = 0
BLAST of MC06g0442 vs. ExPASy TrEMBL
Match: A0A6J1E5I0 (zinc finger protein 7 OS=Cucurbita moschata OX=3662 GN=LOC111429682 PE=4 SV=1) HSP 1 Score: 123 bits (309), Expect = 6.81e-34 Identity = 74/106 (69.81%), Postives = 81/106 (76.42%), Query Frame = 0
BLAST of MC06g0442 vs. ExPASy TrEMBL
Match: A0A6J1KNT5 (zinc finger protein 2-like OS=Cucurbita maxima OX=3661 GN=LOC111497321 PE=4 SV=1) HSP 1 Score: 115 bits (289), Expect = 8.29e-31 Identity = 67/107 (62.62%), Postives = 73/107 (68.22%), Query Frame = 0
BLAST of MC06g0442 vs. ExPASy TrEMBL
Match: A0A384LC37 ((thale cress) hypothetical protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g56770 PE=4 SV=1) HSP 1 Score: 102 bits (255), Expect = 1.35e-25 Identity = 56/77 (72.73%), Postives = 64/77 (83.12%), Query Frame = 0
BLAST of MC06g0442 vs. TAIR 10
Match: AT5G57520.1 (zinc finger protein 2 ) HSP 1 Score: 102.1 bits (253), Expect = 2.9e-22 Identity = 56/77 (72.73%), Postives = 64/77 (83.12%), Query Frame = 0
BLAST of MC06g0442 vs. TAIR 10
Match: AT1G66140.1 (zinc finger protein 4 ) HSP 1 Score: 70.5 bits (171), Expect = 9.4e-13 Identity = 42/74 (56.76%), Postives = 47/74 (63.51%), Query Frame = 0
BLAST of MC06g0442 vs. TAIR 10
Match: AT1G80730.1 (zinc-finger protein 1 ) HSP 1 Score: 70.5 bits (171), Expect = 9.4e-13 Identity = 42/73 (57.53%), Postives = 47/73 (64.38%), Query Frame = 0
BLAST of MC06g0442 vs. TAIR 10
Match: AT1G24625.1 (zinc finger protein 7 ) HSP 1 Score: 70.1 bits (170), Expect = 1.2e-12 Identity = 30/35 (85.71%), Postives = 34/35 (97.14%), Query Frame = 0
BLAST of MC06g0442 vs. TAIR 10
Match: AT5G25160.1 (zinc finger protein 3 ) HSP 1 Score: 68.6 bits (166), Expect = 3.6e-12 Identity = 30/46 (65.22%), Postives = 37/46 (80.43%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|