MC06g0378 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGTCGAAGGTTTCTTTTAAGAGCAAGGGCAAGAGCAGCAAGGGCTCATCGAAGTCTTCTGAGGAGAAATCAGCAACCCAGGCCTTCAAGGAGTGGAGCACTTGGGCCGTCAAGAAAGCCAAGGTCATCACTCACTATGGCTTTATTCCTTTGGTCATCATCATCGGCATGAACTCAGAACCAAAGCCTCACCTCTCCCAGCTTCTCAGCCCCGTC ATGGCGTCGAAGGTTTCTTTTAAGAGCAAGGGCAAGAGCAGCAAGGGCTCATCGAAGTCTTCTGAGGAGAAATCAGCAACCCAGGCCTTCAAGGAGTGGAGCACTTGGGCCGTCAAGAAAGCCAAGGTCATCACTCACTATGGCTTTATTCCTTTGGTCATCATCATCGGCATGAACTCAGAACCAAAGCCTCACCTCTCCCAGCTTCTCAGCCCCGTC ATGGCGTCGAAGGTTTCTTTTAAGAGCAAGGGCAAGAGCAGCAAGGGCTCATCGAAGTCTTCTGAGGAGAAATCAGCAACCCAGGCCTTCAAGGAGTGGAGCACTTGGGCCGTCAAGAAAGCCAAGGTCATCACTCACTATGGCTTTATTCCTTTGGTCATCATCATCGGCATGAACTCAGAACCAAAGCCTCACCTCTCCCAGCTTCTCAGCCCCGTC MASKVSFKSKGKSSKGSSKSSEEKSATQAFKEWSTWAVKKAKVITHYGFIPLVIIIGMNSEPKPHLSQLLSPV Homology
BLAST of MC06g0378 vs. ExPASy Swiss-Prot
Match: Q9ASY8 (Mitochondrial import receptor subunit TOM7-1 OS=Arabidopsis thaliana OX=3702 GN=TOM7-1 PE=1 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 5.0e-18 Identity = 46/66 (69.70%), Postives = 55/66 (83.33%), Query Frame = 0
BLAST of MC06g0378 vs. ExPASy Swiss-Prot
Match: Q3ECI7 (Mitochondrial import receptor subunit TOM7-2 OS=Arabidopsis thaliana OX=3702 GN=TOM7-2 PE=2 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 2.1e-16 Identity = 47/77 (61.04%), Postives = 61/77 (79.22%), Query Frame = 0
BLAST of MC06g0378 vs. ExPASy Swiss-Prot
Match: O82067 (Mitochondrial import receptor subunit TOM7-1 OS=Solanum tuberosum OX=4113 GN=TOM7-1 PE=3 SV=3) HSP 1 Score: 83.6 bits (205), Expect = 1.0e-15 Identity = 46/70 (65.71%), Postives = 53/70 (75.71%), Query Frame = 0
BLAST of MC06g0378 vs. NCBI nr
Match: XP_022134881.1 (mitochondrial import receptor subunit TOM7-1-like [Momordica charantia]) HSP 1 Score: 139 bits (349), Expect = 3.79e-41 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of MC06g0378 vs. NCBI nr
Match: XP_038879584.1 (mitochondrial import receptor subunit TOM7-1-like [Benincasa hispida]) HSP 1 Score: 130 bits (326), Expect = 1.23e-37 Identity = 68/73 (93.15%), Postives = 71/73 (97.26%), Query Frame = 0
BLAST of MC06g0378 vs. NCBI nr
Match: XP_008455820.1 (PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Cucumis melo] >TYJ98347.1 mitochondrial import receptor subunit TOM7-1-like [Cucumis melo var. makuwa]) HSP 1 Score: 129 bits (323), Expect = 3.53e-37 Identity = 68/73 (93.15%), Postives = 70/73 (95.89%), Query Frame = 0
BLAST of MC06g0378 vs. NCBI nr
Match: XP_022921829.1 (mitochondrial import receptor subunit TOM7-1-like [Cucurbita moschata] >XP_022988536.1 mitochondrial import receptor subunit TOM7-1-like [Cucurbita maxima] >XP_023516449.1 mitochondrial import receptor subunit TOM7-1-like [Cucurbita pepo subsp. pepo] >KAG6589655.1 Mitochondrial import receptor subunit TOM7-1, partial [Cucurbita argyrosperma subsp. sororia] >KAG7023343.1 Mitochondrial import receptor subunit TOM7-1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 128 bits (322), Expect = 5.01e-37 Identity = 67/73 (91.78%), Postives = 70/73 (95.89%), Query Frame = 0
BLAST of MC06g0378 vs. NCBI nr
Match: XP_004151870.1 (mitochondrial import receptor subunit TOM7-1 [Cucumis sativus]) HSP 1 Score: 128 bits (322), Expect = 5.01e-37 Identity = 67/73 (91.78%), Postives = 70/73 (95.89%), Query Frame = 0
BLAST of MC06g0378 vs. ExPASy TrEMBL
Match: A0A6J1BZ09 (mitochondrial import receptor subunit TOM7-1-like OS=Momordica charantia OX=3673 GN=LOC111007032 PE=3 SV=1) HSP 1 Score: 139 bits (349), Expect = 1.84e-41 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of MC06g0378 vs. ExPASy TrEMBL
Match: A0A5D3BGU9 (Mitochondrial import receptor subunit TOM7-1-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold232G00780 PE=3 SV=1) HSP 1 Score: 129 bits (323), Expect = 1.71e-37 Identity = 68/73 (93.15%), Postives = 70/73 (95.89%), Query Frame = 0
BLAST of MC06g0378 vs. ExPASy TrEMBL
Match: A0A1S3C1D2 (mitochondrial import receptor subunit TOM7-1-like OS=Cucumis melo OX=3656 GN=LOC103495918 PE=3 SV=1) HSP 1 Score: 129 bits (323), Expect = 1.71e-37 Identity = 68/73 (93.15%), Postives = 70/73 (95.89%), Query Frame = 0
BLAST of MC06g0378 vs. ExPASy TrEMBL
Match: A0A6J1JHG5 (mitochondrial import receptor subunit TOM7-1-like OS=Cucurbita maxima OX=3661 GN=LOC111485747 PE=3 SV=1) HSP 1 Score: 128 bits (322), Expect = 2.43e-37 Identity = 67/73 (91.78%), Postives = 70/73 (95.89%), Query Frame = 0
BLAST of MC06g0378 vs. ExPASy TrEMBL
Match: A0A0A0LN99 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G424720 PE=3 SV=1) HSP 1 Score: 128 bits (322), Expect = 2.43e-37 Identity = 67/73 (91.78%), Postives = 70/73 (95.89%), Query Frame = 0
BLAST of MC06g0378 vs. TAIR 10
Match: AT5G41685.1 (Mitochondrial outer membrane translocase complex, subunit Tom7 ) HSP 1 Score: 91.3 bits (225), Expect = 3.5e-19 Identity = 46/66 (69.70%), Postives = 55/66 (83.33%), Query Frame = 0
BLAST of MC06g0378 vs. TAIR 10
Match: AT1G64220.1 (translocase of outer membrane 7 kDa subunit 2 ) HSP 1 Score: 85.9 bits (211), Expect = 1.5e-17 Identity = 47/77 (61.04%), Postives = 61/77 (79.22%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|