MC05g0793 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TTGTTACACACAACACCCCTTAGAGGAAGGGCCAAGCAAGGTGGACAACGGGTGGGAGAAATAGAGGTTTGGGCTCTAGAGGGATTTGGTGTTGCTCATATTTTGCAAGAGATGCTTACTTATAAATCTGATCATATTAGAGCTCGGCAAGATATACTTGATACTACGATCATC TTGTTACACACAACACCCCTTAGAGGAAGGGCCAAGCAAGGTGGACAACGGGTGGGAGAAATAGAGGTTTGGGCTCTAGAGGGATTTGGTGTTGCTCATATTTTGCAAGAGATGCTTACTTATAAATCTGATCATATTAGAGCTCGGCAAGATATACTTGATACTACGATCATC TTGTTACACACAACACCCCTTAGAGGAAGGGCCAAGCAAGGTGGACAACGGGTGGGAGAAATAGAGGTTTGGGCTCTAGAGGGATTTGGTGTTGCTCATATTTTGCAAGAGATGCTTACTTATAAATCTGATCATATTAGAGCTCGGCAAGATATACTTGATACTACGATCATC LLHTTPLRGRAKQGGQRVGEIEVWALEGFGVAHILQEMLTYKSDHIRARQDILDTTII Homology
BLAST of MC05g0793 vs. ExPASy Swiss-Prot
Match: Q589C0 (DNA-directed RNA polymerase subunit beta OS=Silene latifolia OX=37657 GN=rpoB PE=3 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 1.5e-22 Identity = 50/58 (86.21%), Postives = 54/58 (93.10%), Query Frame = 0
BLAST of MC05g0793 vs. ExPASy Swiss-Prot
Match: A9LYH7 (DNA-directed RNA polymerase subunit beta OS=Acorus americanus OX=263995 GN=rpoB PE=3 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 2.0e-22 Identity = 50/58 (86.21%), Postives = 54/58 (93.10%), Query Frame = 0
BLAST of MC05g0793 vs. ExPASy Swiss-Prot
Match: Q3V542 (DNA-directed RNA polymerase subunit beta OS=Acorus calamus OX=4465 GN=rpoB PE=3 SV=2) HSP 1 Score: 105.5 bits (262), Expect = 2.0e-22 Identity = 50/58 (86.21%), Postives = 54/58 (93.10%), Query Frame = 0
BLAST of MC05g0793 vs. ExPASy Swiss-Prot
Match: Q5QA72 (DNA-directed RNA polymerase subunit beta OS=Acorus gramineus OX=55184 GN=rpoB PE=3 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 2.0e-22 Identity = 50/58 (86.21%), Postives = 54/58 (93.10%), Query Frame = 0
BLAST of MC05g0793 vs. ExPASy Swiss-Prot
Match: Q8S8X9 (DNA-directed RNA polymerase subunit beta OS=Atropa belladonna OX=33113 GN=rpoB PE=3 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 2.0e-22 Identity = 50/58 (86.21%), Postives = 54/58 (93.10%), Query Frame = 0
BLAST of MC05g0793 vs. NCBI nr
Match: BBN70082.1 (hypothetical protein Prudu_1405S000400 [Prunus dulcis]) HSP 1 Score: 104 bits (260), Expect = 2.76e-27 Identity = 50/58 (86.21%), Postives = 54/58 (93.10%), Query Frame = 0
BLAST of MC05g0793 vs. NCBI nr
Match: NLZ73073.1 (DNA-directed RNA polymerase subunit beta [Bacteroidales bacterium]) HSP 1 Score: 104 bits (259), Expect = 5.36e-27 Identity = 49/58 (84.48%), Postives = 54/58 (93.10%), Query Frame = 0
BLAST of MC05g0793 vs. NCBI nr
Match: VVW90808.1 (unnamed protein product, partial [Nymphaea colorata]) HSP 1 Score: 104 bits (259), Expect = 1.73e-26 Identity = 49/58 (84.48%), Postives = 54/58 (93.10%), Query Frame = 0
BLAST of MC05g0793 vs. NCBI nr
Match: WP_199287517.1 (hypothetical protein, partial [Photobacterium chitinilyticum] >RWX52626.1 DNA-directed RNA polymerase subunit beta, partial [Photobacterium chitinilyticum]) HSP 1 Score: 103 bits (257), Expect = 2.21e-26 Identity = 49/58 (84.48%), Postives = 54/58 (93.10%), Query Frame = 0
BLAST of MC05g0793 vs. NCBI nr
Match: VVW90363.1 (unnamed protein product, partial [Nymphaea colorata]) HSP 1 Score: 104 bits (259), Expect = 3.19e-26 Identity = 49/58 (84.48%), Postives = 54/58 (93.10%), Query Frame = 0
BLAST of MC05g0793 vs. ExPASy TrEMBL
Match: A0A5H2XTM0 (DNA-directed RNA polymerase OS=Prunus dulcis OX=3755 GN=Prudu_1405S000400 PE=3 SV=1) HSP 1 Score: 104 bits (260), Expect = 1.34e-27 Identity = 50/58 (86.21%), Postives = 54/58 (93.10%), Query Frame = 0
BLAST of MC05g0793 vs. ExPASy TrEMBL
Match: A0A7X8ZSZ9 (DNA-directed RNA polymerase subunit beta OS=Bacteroidales bacterium OX=2030927 GN=GX905_04560 PE=4 SV=1) HSP 1 Score: 104 bits (259), Expect = 2.59e-27 Identity = 49/58 (84.48%), Postives = 54/58 (93.10%), Query Frame = 0
BLAST of MC05g0793 vs. ExPASy TrEMBL
Match: A0A5K1HTK9 (DNA-directed RNA polymerase (Fragment) OS=Nymphaea colorata OX=210225 GN=NYM_LOCUS30763 PE=3 SV=1) HSP 1 Score: 104 bits (259), Expect = 8.38e-27 Identity = 49/58 (84.48%), Postives = 54/58 (93.10%), Query Frame = 0
BLAST of MC05g0793 vs. ExPASy TrEMBL
Match: A0A444JHR1 (DNA-directed RNA polymerase (Fragment) OS=Photobacterium chitinilyticum OX=2485123 GN=EDI28_26660 PE=4 SV=1) HSP 1 Score: 103 bits (257), Expect = 1.07e-26 Identity = 49/58 (84.48%), Postives = 54/58 (93.10%), Query Frame = 0
BLAST of MC05g0793 vs. ExPASy TrEMBL
Match: A0A5K1HR94 (DNA-directed RNA polymerase (Fragment) OS=Nymphaea colorata OX=210225 GN=NYM_LOCUS30651 PE=3 SV=1) HSP 1 Score: 104 bits (259), Expect = 1.54e-26 Identity = 49/58 (84.48%), Postives = 54/58 (93.10%), Query Frame = 0
BLAST of MC05g0793 vs. TAIR 10
Match: ATCG00190.1 (RNA polymerase subunit beta ) HSP 1 Score: 104.4 bits (259), Expect = 3.2e-23 Identity = 49/58 (84.48%), Postives = 54/58 (93.10%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|