
MC05g0446 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.CCGCAGGAGCAATTGAACTGCCCGAGATGCAAATCAAACAACACCAAATTTTGCTACTACAATAACTACAGCCTTACTCAGCCGCGCTACTTTTGTAAATCTTGCCGCCGGTATTGGACCGAGGGCGGCTCTCTCAGAAACATCCCCGTCGGCGGTGGCTCTCGGAAAAATAGGAAACCGTCGTCCGGTTCAGTT CCGCAGGAGCAATTGAACTGCCCGAGATGCAAATCAAACAACACCAAATTTTGCTACTACAATAACTACAGCCTTACTCAGCCGCGCTACTTTTGTAAATCTTGCCGCCGGTATTGGACCGAGGGCGGCTCTCTCAGAAACATCCCCGTCGGCGGTGGCTCTCGGAAAAATAGGAAACCGTCGTCCGGTTCAGTT CCGCAGGAGCAATTGAACTGCCCGAGATGCAAATCAAACAACACCAAATTTTGCTACTACAATAACTACAGCCTTACTCAGCCGCGCTACTTTTGTAAATCTTGCCGCCGGTATTGGACCGAGGGCGGCTCTCTCAGAAACATCCCCGTCGGCGGTGGCTCTCGGAAAAATAGGAAACCGTCGTCCGGTTCAGTT PQEQLNCPRCKSNNTKFCYYNNYSLTQPRYFCKSCRRYWTEGGSLRNIPVGGGSRKNRKPSSGSV Homology
BLAST of MC05g0446 vs. ExPASy Swiss-Prot
Match: Q9ZPY0 (Dof zinc finger protein DOF2.5 OS=Arabidopsis thaliana OX=3702 GN=DOF2.5 PE=2 SV=3) HSP 1 Score: 124.8 bits (312), Expect = 3.6e-28 Identity = 54/64 (84.38%), Postives = 58/64 (90.62%), Query Frame = 0
BLAST of MC05g0446 vs. ExPASy Swiss-Prot
Match: Q43385 (Dof zinc finger protein DOF3.7 OS=Arabidopsis thaliana OX=3702 GN=DOF3.7 PE=1 SV=2) HSP 1 Score: 121.7 bits (304), Expect = 3.0e-27 Identity = 51/62 (82.26%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of MC05g0446 vs. ExPASy Swiss-Prot
Match: Q9M161 (Dof zinc finger protein DOF4.1 OS=Arabidopsis thaliana OX=3702 GN=DOF4.1 PE=2 SV=2) HSP 1 Score: 119.8 bits (299), Expect = 1.2e-26 Identity = 51/59 (86.44%), Postives = 54/59 (91.53%), Query Frame = 0
BLAST of MC05g0446 vs. ExPASy Swiss-Prot
Match: B9F1L8 (Dof zinc finger protein 2 OS=Oryza sativa subsp. japonica OX=39947 GN=DOF2 PE=2 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 2.6e-26 Identity = 51/64 (79.69%), Postives = 57/64 (89.06%), Query Frame = 0
BLAST of MC05g0446 vs. ExPASy Swiss-Prot
Match: Q9SXG8 (Dof zinc finger protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=DOF1 PE=2 SV=1) HSP 1 Score: 117.9 bits (294), Expect = 4.4e-26 Identity = 50/63 (79.37%), Postives = 57/63 (90.48%), Query Frame = 0
BLAST of MC05g0446 vs. NCBI nr
Match: XP_022147440.1 (dof zinc finger protein DOF3.7-like isoform X2 [Momordica charantia]) HSP 1 Score: 145 bits (365), Expect = 4.71e-42 Identity = 65/65 (100.00%), Postives = 65/65 (100.00%), Query Frame = 0
BLAST of MC05g0446 vs. NCBI nr
Match: XP_022147439.1 (dof zinc finger protein DOF3.7-like isoform X1 [Momordica charantia]) HSP 1 Score: 145 bits (365), Expect = 5.13e-42 Identity = 65/65 (100.00%), Postives = 65/65 (100.00%), Query Frame = 0
BLAST of MC05g0446 vs. NCBI nr
Match: XP_023527390.1 (dof zinc finger protein 2 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 135 bits (340), Expect = 1.19e-38 Identity = 59/61 (96.72%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of MC05g0446 vs. NCBI nr
Match: XP_011650669.1 (dof zinc finger protein 2 [Cucumis sativus] >KGN56409.1 hypothetical protein Csa_011000 [Cucumis sativus]) HSP 1 Score: 135 bits (340), Expect = 1.19e-38 Identity = 59/60 (98.33%), Postives = 60/60 (100.00%), Query Frame = 0
BLAST of MC05g0446 vs. NCBI nr
Match: XP_022980851.1 (dof zinc finger protein 2-like [Cucurbita maxima]) HSP 1 Score: 135 bits (340), Expect = 1.30e-38 Identity = 59/61 (96.72%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of MC05g0446 vs. ExPASy TrEMBL
Match: A0A6J1D062 (dof zinc finger protein DOF3.7-like isoform X2 OS=Momordica charantia OX=3673 GN=LOC111016364 PE=4 SV=1) HSP 1 Score: 145 bits (365), Expect = 2.28e-42 Identity = 65/65 (100.00%), Postives = 65/65 (100.00%), Query Frame = 0
BLAST of MC05g0446 vs. ExPASy TrEMBL
Match: A0A6J1D105 (dof zinc finger protein DOF3.7-like isoform X1 OS=Momordica charantia OX=3673 GN=LOC111016364 PE=4 SV=1) HSP 1 Score: 145 bits (365), Expect = 2.48e-42 Identity = 65/65 (100.00%), Postives = 65/65 (100.00%), Query Frame = 0
BLAST of MC05g0446 vs. ExPASy TrEMBL
Match: A0A0A0L5U8 (Dof-type domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_3G119420 PE=4 SV=1) HSP 1 Score: 135 bits (340), Expect = 5.77e-39 Identity = 59/60 (98.33%), Postives = 60/60 (100.00%), Query Frame = 0
BLAST of MC05g0446 vs. ExPASy TrEMBL
Match: A0A6J1IUS0 (dof zinc finger protein 2-like OS=Cucurbita maxima OX=3661 GN=LOC111480120 PE=4 SV=1) HSP 1 Score: 135 bits (340), Expect = 6.29e-39 Identity = 59/61 (96.72%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of MC05g0446 vs. ExPASy TrEMBL
Match: A0A6J1ED97 (dof zinc finger protein 2-like OS=Cucurbita moschata OX=3662 GN=LOC111432129 PE=4 SV=1) HSP 1 Score: 135 bits (339), Expect = 7.06e-39 Identity = 59/60 (98.33%), Postives = 59/60 (98.33%), Query Frame = 0
BLAST of MC05g0446 vs. TAIR 10
Match: AT2G46590.1 (Dof-type zinc finger DNA-binding family protein ) HSP 1 Score: 124.8 bits (312), Expect = 2.6e-29 Identity = 54/64 (84.38%), Postives = 58/64 (90.62%), Query Frame = 0
BLAST of MC05g0446 vs. TAIR 10
Match: AT2G46590.2 (Dof-type zinc finger DNA-binding family protein ) HSP 1 Score: 124.8 bits (312), Expect = 2.6e-29 Identity = 54/64 (84.38%), Postives = 58/64 (90.62%), Query Frame = 0
BLAST of MC05g0446 vs. TAIR 10
Match: AT3G61850.1 (Dof-type zinc finger DNA-binding family protein ) HSP 1 Score: 121.7 bits (304), Expect = 2.2e-28 Identity = 51/62 (82.26%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of MC05g0446 vs. TAIR 10
Match: AT3G61850.2 (Dof-type zinc finger DNA-binding family protein ) HSP 1 Score: 121.7 bits (304), Expect = 2.2e-28 Identity = 51/62 (82.26%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of MC05g0446 vs. TAIR 10
Match: AT3G61850.3 (Dof-type zinc finger DNA-binding family protein ) HSP 1 Score: 121.7 bits (304), Expect = 2.2e-28 Identity = 51/62 (82.26%), Postives = 57/62 (91.94%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|