
MC05g0189 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ACACTCAATGGGAACCCCAATAACCACATCTTTGGAATTAAATTCGATATGTTTGCCAACTCAAGAATTCAACGACCCCAACAAAAATCATGTGGGAATCGATTTTAATTCTCTGACCTCTAACTTGACCGATGGCGGTGGGTTTTGG ACACTCAATGGGAACCCCAATAACCACATCTTTGGAATTAAATTCGATATGTTTGCCAACGAATTCAACGACCCCAACAAAAATCATGTGGGAATCGATTTTAATTCTCTGACCTCTAACTTGACCGATGGCGGTGGGTTTTGG ACACTCAATGGGAACCCCAATAACCACATCTTTGGAATTAAATTCGATATGTTTGCCAACGAATTCAACGACCCCAACAAAAATCATGTGGGAATCGATTTTAATTCTCTGACCTCTAACTTGACCGATGGCGGTGGGTTTTGG TLNGNPNNHIFGIKFDMFANEFNDPNKNHVGIDFNSLTSNLTDGGGFW Homology
BLAST of MC05g0189 vs. ExPASy Swiss-Prot
Match: Q9S9U1 (L-type lectin-domain containing receptor kinase VII.1 OS=Arabidopsis thaliana OX=3702 GN=LECRK71 PE=2 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 1.2e-09 Identity = 30/49 (61.22%), Postives = 39/49 (79.59%), Query Frame = 0
BLAST of MC05g0189 vs. ExPASy Swiss-Prot
Match: O49445 (Probable L-type lectin-domain containing receptor kinase VII.2 OS=Arabidopsis thaliana OX=3702 GN=LECRK72 PE=3 SV=2) HSP 1 Score: 59.7 bits (143), Expect = 1.1e-08 Identity = 29/49 (59.18%), Postives = 38/49 (77.55%), Query Frame = 0
BLAST of MC05g0189 vs. ExPASy Swiss-Prot
Match: Q9LNN3 (Lectin-like protein At1g53080 OS=Arabidopsis thaliana OX=3702 GN=At1g53080 PE=2 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 2.3e-08 Identity = 24/49 (48.98%), Postives = 37/49 (75.51%), Query Frame = 0
BLAST of MC05g0189 vs. ExPASy Swiss-Prot
Match: Q9LZF5 (Lectin-like protein OS=Arabidopsis thaliana OX=3702 GN=LLP PE=1 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 6.8e-08 Identity = 26/49 (53.06%), Postives = 36/49 (73.47%), Query Frame = 0
BLAST of MC05g0189 vs. ExPASy Swiss-Prot
Match: Q9LNN2 (Lectin-like protein At1g53070 OS=Arabidopsis thaliana OX=3702 GN=At1g53070 PE=2 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 3.4e-07 Identity = 25/49 (51.02%), Postives = 35/49 (71.43%), Query Frame = 0
BLAST of MC05g0189 vs. NCBI nr
Match: XP_022139790.1 (L-type lectin-domain containing receptor kinase VII.1-like [Momordica charantia]) HSP 1 Score: 87.4 bits (215), Expect = 1.96e-18 Identity = 40/49 (81.63%), Postives = 44/49 (89.80%), Query Frame = 0
BLAST of MC05g0189 vs. NCBI nr
Match: XP_022137303.1 (L-type lectin-domain containing receptor kinase VII.1-like [Momordica charantia]) HSP 1 Score: 82.8 bits (203), Expect = 1.30e-17 Identity = 38/49 (77.55%), Postives = 44/49 (89.80%), Query Frame = 0
BLAST of MC05g0189 vs. NCBI nr
Match: XP_022994351.1 (L-type lectin-domain containing receptor kinase VII.1-like isoform X2 [Cucurbita maxima]) HSP 1 Score: 80.5 bits (197), Expect = 5.34e-16 Identity = 37/49 (75.51%), Postives = 42/49 (85.71%), Query Frame = 0
BLAST of MC05g0189 vs. NCBI nr
Match: XP_022954484.1 (L-type lectin-domain containing receptor kinase VII.1-like isoform X2 [Cucurbita moschata]) HSP 1 Score: 80.5 bits (197), Expect = 5.34e-16 Identity = 37/49 (75.51%), Postives = 42/49 (85.71%), Query Frame = 0
BLAST of MC05g0189 vs. NCBI nr
Match: KAG7012434.1 (L-type lectin-domain containing receptor kinase VII.1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 80.5 bits (197), Expect = 5.37e-16 Identity = 37/49 (75.51%), Postives = 42/49 (85.71%), Query Frame = 0
BLAST of MC05g0189 vs. ExPASy TrEMBL
Match: A0A6J1CDA4 (L-type lectin-domain containing receptor kinase VII.1-like OS=Momordica charantia OX=3673 GN=LOC111010621 PE=3 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 9.51e-19 Identity = 40/49 (81.63%), Postives = 44/49 (89.80%), Query Frame = 0
BLAST of MC05g0189 vs. ExPASy TrEMBL
Match: A0A6J1C9Y9 (L-type lectin-domain containing receptor kinase VII.1-like OS=Momordica charantia OX=3673 GN=LOC111008800 PE=3 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 6.29e-18 Identity = 38/49 (77.55%), Postives = 44/49 (89.80%), Query Frame = 0
BLAST of MC05g0189 vs. ExPASy TrEMBL
Match: A0A6J1JYW5 (L-type lectin-domain containing receptor kinase VII.1-like isoform X2 OS=Cucurbita maxima OX=3661 GN=LOC111490097 PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 2.58e-16 Identity = 37/49 (75.51%), Postives = 42/49 (85.71%), Query Frame = 0
BLAST of MC05g0189 vs. ExPASy TrEMBL
Match: A0A6J1GT45 (L-type lectin-domain containing receptor kinase VII.1-like isoform X2 OS=Cucurbita moschata OX=3662 GN=LOC111456737 PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 2.58e-16 Identity = 37/49 (75.51%), Postives = 42/49 (85.71%), Query Frame = 0
BLAST of MC05g0189 vs. ExPASy TrEMBL
Match: A0A6J1GR80 (L-type lectin-domain containing receptor kinase VII.1-like isoform X1 OS=Cucurbita moschata OX=3662 GN=LOC111456737 PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 2.60e-16 Identity = 37/49 (75.51%), Postives = 42/49 (85.71%), Query Frame = 0
BLAST of MC05g0189 vs. TAIR 10
Match: AT4G04960.1 (Concanavalin A-like lectin protein kinase family protein ) HSP 1 Score: 62.8 bits (151), Expect = 8.8e-11 Identity = 30/49 (61.22%), Postives = 39/49 (79.59%), Query Frame = 0
BLAST of MC05g0189 vs. TAIR 10
Match: AT4G28350.1 (Concanavalin A-like lectin protein kinase family protein ) HSP 1 Score: 59.7 bits (143), Expect = 7.5e-10 Identity = 29/49 (59.18%), Postives = 38/49 (77.55%), Query Frame = 0
BLAST of MC05g0189 vs. TAIR 10
Match: AT1G53080.1 (Legume lectin family protein ) HSP 1 Score: 58.5 bits (140), Expect = 1.7e-09 Identity = 24/49 (48.98%), Postives = 37/49 (75.51%), Query Frame = 0
BLAST of MC05g0189 vs. TAIR 10
Match: AT5G03350.1 (Legume lectin family protein ) HSP 1 Score: 57.0 bits (136), Expect = 4.8e-09 Identity = 26/49 (53.06%), Postives = 36/49 (73.47%), Query Frame = 0
BLAST of MC05g0189 vs. TAIR 10
Match: AT1G53070.1 (Legume lectin family protein ) HSP 1 Score: 54.7 bits (130), Expect = 2.4e-08 Identity = 25/49 (51.02%), Postives = 35/49 (71.43%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|