
MC05g0053 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TTAGGAAAGAGTTCGTGGCCGGAGCTGGTGGGCAAACTGGGAAAGGACGCAGAGAAAACCATCGAGAGGGAGAATGGTTTGGTTGATGCGGTGATTGTTGGCGAAGGCTCAATTGTGACTCTTGACTTCAGGTGCGACAGGGTGTGGGTTTGGGTGAACAACAAAACTGGTAGGGTTACTAGGACTCCTACCATTGGT TTAGGAAAGAGTTCGTGGCCGGAGCTGGTGGGCAAACTGGGAAAGGACGCAGAGAAAACCATCGAGAGGGAGAATGGTTTGGTTGATGCGGTGATTGTTGGCGAAGGCTCAATTGTGACTCTTGACTTCAGGTGCGACAGGGTGTGGGTTTGGGTGAACAACAAAACTGGTAGGGTTACTAGGACTCCTACCATTGGT TTAGGAAAGAGTTCGTGGCCGGAGCTGGTGGGCAAACTGGGAAAGGACGCAGAGAAAACCATCGAGAGGGAGAATGGTTTGGTTGATGCGGTGATTGTTGGCGAAGGCTCAATTGTGACTCTTGACTTCAGGTGCGACAGGGTGTGGGTTTGGGTGAACAACAAAACTGGTAGGGTTACTAGGACTCCTACCATTGGT LGKSSWPELVGKLGKDAEKTIERENGLVDAVIVGEGSIVTLDFRCDRVWVWVNNKTGRVTRTPTIG Homology
BLAST of MC05g0053 vs. ExPASy Swiss-Prot
Match: P82381 (Proteinase inhibitor OS=Linum usitatissimum OX=4006 PE=1 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 1.5e-13 Identity = 38/64 (59.38%), Postives = 46/64 (71.88%), Query Frame = 0
BLAST of MC05g0053 vs. ExPASy Swiss-Prot
Match: P24076 (Glu S.griseus protease inhibitor OS=Momordica charantia OX=3673 PE=1 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 4.3e-13 Identity = 40/65 (61.54%), Postives = 43/65 (66.15%), Query Frame = 0
BLAST of MC05g0053 vs. ExPASy Swiss-Prot
Match: P19873 (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima OX=3661 PE=1 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 8.2e-12 Identity = 38/65 (58.46%), Postives = 44/65 (67.69%), Query Frame = 0
BLAST of MC05g0053 vs. ExPASy Swiss-Prot
Match: P86971 (Trypsin inhibitor OS=Fagopyrum tataricum OX=62330 PE=1 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 5.3e-11 Identity = 36/70 (51.43%), Postives = 44/70 (62.86%), Query Frame = 0
BLAST of MC05g0053 vs. ExPASy Swiss-Prot
Match: P80211 (Trypsin/subtilisin inhibitor OS=Amaranthus caudatus OX=3567 PE=1 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 9.1e-11 Identity = 35/64 (54.69%), Postives = 42/64 (65.62%), Query Frame = 0
BLAST of MC05g0053 vs. NCBI nr
Match: KAA0049295.1 (inhibitor of trypsin and hageman factor-like [Cucumis melo var. makuwa] >TYK17263.1 inhibitor of trypsin and hageman factor-like [Cucumis melo var. makuwa]) HSP 1 Score: 109 bits (273), Expect = 1.06e-29 Identity = 52/65 (80.00%), Postives = 56/65 (86.15%), Query Frame = 0
BLAST of MC05g0053 vs. NCBI nr
Match: XP_004134090.1 (glu S.griseus protease inhibitor [Cucumis sativus]) HSP 1 Score: 107 bits (268), Expect = 6.15e-29 Identity = 51/65 (78.46%), Postives = 56/65 (86.15%), Query Frame = 0
BLAST of MC05g0053 vs. NCBI nr
Match: KAE8650342.1 (hypothetical protein Csa_009611 [Cucumis sativus]) HSP 1 Score: 107 bits (268), Expect = 3.82e-28 Identity = 51/65 (78.46%), Postives = 56/65 (86.15%), Query Frame = 0
BLAST of MC05g0053 vs. NCBI nr
Match: KAG6582359.1 (hypothetical protein SDJN03_22361, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 105 bits (261), Expect = 7.20e-28 Identity = 49/65 (75.38%), Postives = 55/65 (84.62%), Query Frame = 0
BLAST of MC05g0053 vs. NCBI nr
Match: KAG6582360.1 (hypothetical protein SDJN03_22362, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 104 bits (260), Expect = 9.95e-28 Identity = 50/65 (76.92%), Postives = 54/65 (83.08%), Query Frame = 0
BLAST of MC05g0053 vs. ExPASy TrEMBL
Match: A0A5D3CZE2 (Inhibitor of trypsin and hageman factor-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold434G001160 PE=3 SV=1) HSP 1 Score: 109 bits (273), Expect = 5.14e-30 Identity = 52/65 (80.00%), Postives = 56/65 (86.15%), Query Frame = 0
BLAST of MC05g0053 vs. ExPASy TrEMBL
Match: A0A0A0L795 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142960 PE=3 SV=1) HSP 1 Score: 107 bits (268), Expect = 2.98e-29 Identity = 51/65 (78.46%), Postives = 56/65 (86.15%), Query Frame = 0
BLAST of MC05g0053 vs. ExPASy TrEMBL
Match: A0A5D3D207 (Inhibitor of trypsin and hageman factor-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold434G001170 PE=3 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 7.92e-25 Identity = 45/65 (69.23%), Postives = 53/65 (81.54%), Query Frame = 0
BLAST of MC05g0053 vs. ExPASy TrEMBL
Match: A0A4Y7J9L1 (Uncharacterized protein OS=Papaver somniferum OX=3469 GN=C5167_005120 PE=3 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 6.51e-24 Identity = 44/65 (67.69%), Postives = 53/65 (81.54%), Query Frame = 0
BLAST of MC05g0053 vs. ExPASy TrEMBL
Match: A0A5N6MCE0 (Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_33846 PE=3 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 9.01e-24 Identity = 45/65 (69.23%), Postives = 52/65 (80.00%), Query Frame = 0
BLAST of MC05g0053 vs. TAIR 10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 70.5 bits (171), Expect = 5.8e-13 Identity = 35/65 (53.85%), Postives = 47/65 (72.31%), Query Frame = 0
BLAST of MC05g0053 vs. TAIR 10
Match: AT5G43570.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 63.5 bits (153), Expect = 7.1e-11 Identity = 32/61 (52.46%), Postives = 44/61 (72.13%), Query Frame = 0
BLAST of MC05g0053 vs. TAIR 10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 61.2 bits (147), Expect = 3.5e-10 Identity = 33/64 (51.56%), Postives = 41/64 (64.06%), Query Frame = 0
BLAST of MC05g0053 vs. TAIR 10
Match: AT2G38900.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 58.9 bits (141), Expect = 1.8e-09 Identity = 30/66 (45.45%), Postives = 41/66 (62.12%), Query Frame = 0
BLAST of MC05g0053 vs. TAIR 10
Match: AT2G38900.2 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 58.9 bits (141), Expect = 1.8e-09 Identity = 30/66 (45.45%), Postives = 41/66 (62.12%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|