![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MC04g1889 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTTTGTGGACGCTATTAGAGGGTTGTCTGCTTCTTGCGAATGCACTAGCAATACTAAATGAAGATCGTTTTCTTGCTCCTCGTGGATTGAGCTTCTCCGAGTTCTCAGGAGGTAGAACAAAGTCATTCAAGGGGCAGCTTATAGGCCTTATCTACGCAACACAATATTTGAGGGTTCCTCTCATAATGCTCAATGCAATCTGTATCTTTGTAAAGTTGGTATCTGGA ATGGGTTTGTGGACGCTATTAGAGGGTTGTCTGCTTCTTGCGAATGCACTAGCAATACTAAATGAAGATCGTTTTCTTGCTCCTCGTGGATTGAGCTTCTCCGAGTTCTCAGGAGGTAGAACAAAGTCATTCAAGGGGCAGCTTATAGGCCTTATCTACGCAACACAATATTTGAGGGTTCCTCTCATAATGCTCAATGCAATCTGTATCTTTGTAAAGTTGGTATCTGGA ATGGGTTTGTGGACGCTATTAGAGGGTTGTCTGCTTCTTGCGAATGCACTAGCAATACTAAATGAAGATCGTTTTCTTGCTCCTCGTGGATTGAGCTTCTCCGAGTTCTCAGGAGGTAGAACAAAGTCATTCAAGGGGCAGCTTATAGGCCTTATCTACGCAACACAATATTTGAGGGTTCCTCTCATAATGCTCAATGCAATCTGTATCTTTGTAAAGTTGGTATCTGGA MGLWTLLEGCLLLANALAILNEDRFLAPRGLSFSEFSGGRTKSFKGQLIGLIYATQYLRVPLIMLNAICIFVKLVSG Homology
BLAST of MC04g1889 vs. ExPASy Swiss-Prot
Match: Q3B8G7 (Immediate early response 3-interacting protein 1 OS=Xenopus laevis OX=8355 GN=ier3ip1 PE=3 SV=1) HSP 1 Score: 48.9 bits (115), Expect = 3.0e-05 Identity = 31/78 (39.74%), Postives = 48/78 (61.54%), Query Frame = 0
BLAST of MC04g1889 vs. ExPASy Swiss-Prot
Match: Q4VBI2 (Immediate early response 3-interacting protein 1 OS=Danio rerio OX=7955 GN=ier3ip1 PE=3 SV=1) HSP 1 Score: 48.5 bits (114), Expect = 3.9e-05 Identity = 29/78 (37.18%), Postives = 48/78 (61.54%), Query Frame = 0
BLAST of MC04g1889 vs. ExPASy Swiss-Prot
Match: Q1JQC2 (Immediate early response 3-interacting protein 1 OS=Bos taurus OX=9913 GN=IER3IP1 PE=3 SV=1) HSP 1 Score: 47.8 bits (112), Expect = 6.6e-05 Identity = 31/78 (39.74%), Postives = 48/78 (61.54%), Query Frame = 0
BLAST of MC04g1889 vs. ExPASy Swiss-Prot
Match: Q9Y5U9 (Immediate early response 3-interacting protein 1 OS=Homo sapiens OX=9606 GN=IER3IP1 PE=1 SV=1) HSP 1 Score: 47.8 bits (112), Expect = 6.6e-05 Identity = 31/78 (39.74%), Postives = 48/78 (61.54%), Query Frame = 0
BLAST of MC04g1889 vs. ExPASy Swiss-Prot
Match: P85007 (Immediate early response 3-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Ier3ip1 PE=3 SV=1) HSP 1 Score: 47.0 bits (110), Expect = 1.1e-04 Identity = 30/78 (38.46%), Postives = 48/78 (61.54%), Query Frame = 0
BLAST of MC04g1889 vs. NCBI nr
Match: XP_022134292.1 (immediate early response 3-interacting protein 1-like [Momordica charantia] >XP_022134293.1 immediate early response 3-interacting protein 1-like [Momordica charantia] >XP_038892190.1 immediate early response 3-interacting protein 1-like [Benincasa hispida] >XP_038892191.1 immediate early response 3-interacting protein 1-like [Benincasa hispida] >XP_038892192.1 immediate early response 3-interacting protein 1-like [Benincasa hispida] >XP_038892193.1 immediate early response 3-interacting protein 1-like [Benincasa hispida] >XP_038892194.1 immediate early response 3-interacting protein 1-like [Benincasa hispida]) HSP 1 Score: 150 bits (379), Expect = 1.33e-45 Identity = 77/77 (100.00%), Postives = 77/77 (100.00%), Query Frame = 0
BLAST of MC04g1889 vs. NCBI nr
Match: XP_031743934.1 (immediate early response 3-interacting protein 1 [Cucumis sativus]) HSP 1 Score: 149 bits (376), Expect = 3.81e-45 Identity = 76/77 (98.70%), Postives = 77/77 (100.00%), Query Frame = 0
BLAST of MC04g1889 vs. NCBI nr
Match: XP_008441413.1 (PREDICTED: immediate early response 3-interacting protein 1-like [Cucumis melo] >XP_008441414.1 PREDICTED: immediate early response 3-interacting protein 1-like [Cucumis melo] >XP_008441415.1 PREDICTED: immediate early response 3-interacting protein 1-like [Cucumis melo]) HSP 1 Score: 149 bits (375), Expect = 5.41e-45 Identity = 75/77 (97.40%), Postives = 77/77 (100.00%), Query Frame = 0
BLAST of MC04g1889 vs. NCBI nr
Match: XP_022952849.1 (immediate early response 3-interacting protein 1-like [Cucurbita moschata]) HSP 1 Score: 145 bits (367), Expect = 9.00e-44 Identity = 74/77 (96.10%), Postives = 76/77 (98.70%), Query Frame = 0
BLAST of MC04g1889 vs. NCBI nr
Match: XP_022990010.1 (immediate early response 3-interacting protein 1-like [Cucurbita maxima]) HSP 1 Score: 143 bits (361), Expect = 7.41e-43 Identity = 73/77 (94.81%), Postives = 75/77 (97.40%), Query Frame = 0
BLAST of MC04g1889 vs. ExPASy TrEMBL
Match: A0A6J1C1M0 (immediate early response 3-interacting protein 1-like OS=Momordica charantia OX=3673 GN=LOC111006591 PE=3 SV=1) HSP 1 Score: 150 bits (379), Expect = 6.42e-46 Identity = 77/77 (100.00%), Postives = 77/77 (100.00%), Query Frame = 0
BLAST of MC04g1889 vs. ExPASy TrEMBL
Match: A0A0A0KBI3 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G009360 PE=3 SV=1) HSP 1 Score: 149 bits (376), Expect = 1.84e-45 Identity = 76/77 (98.70%), Postives = 77/77 (100.00%), Query Frame = 0
BLAST of MC04g1889 vs. ExPASy TrEMBL
Match: A0A1S3B419 (immediate early response 3-interacting protein 1-like OS=Cucumis melo OX=3656 GN=LOC103485539 PE=3 SV=1) HSP 1 Score: 149 bits (375), Expect = 2.62e-45 Identity = 75/77 (97.40%), Postives = 77/77 (100.00%), Query Frame = 0
BLAST of MC04g1889 vs. ExPASy TrEMBL
Match: A0A6J1GMX2 (immediate early response 3-interacting protein 1-like OS=Cucurbita moschata OX=3662 GN=LOC111455413 PE=3 SV=1) HSP 1 Score: 145 bits (367), Expect = 4.36e-44 Identity = 74/77 (96.10%), Postives = 76/77 (98.70%), Query Frame = 0
BLAST of MC04g1889 vs. ExPASy TrEMBL
Match: A0A6J1JNY1 (immediate early response 3-interacting protein 1-like OS=Cucurbita maxima OX=3661 GN=LOC111487030 PE=3 SV=1) HSP 1 Score: 143 bits (361), Expect = 3.59e-43 Identity = 73/77 (94.81%), Postives = 75/77 (97.40%), Query Frame = 0
BLAST of MC04g1889 vs. TAIR 10
Match: AT2G37975.1 (Yos1-like protein ) HSP 1 Score: 90.9 bits (224), Expect = 4.9e-19 Identity = 47/78 (60.26%), Postives = 58/78 (74.36%), Query Frame = 0
BLAST of MC04g1889 vs. TAIR 10
Match: AT3G54085.1 (Yos1-like protein ) HSP 1 Score: 89.7 bits (221), Expect = 1.1e-18 Identity = 47/78 (60.26%), Postives = 58/78 (74.36%), Query Frame = 0
BLAST of MC04g1889 vs. TAIR 10
Match: AT3G54085.2 (Yos1-like protein ) HSP 1 Score: 89.7 bits (221), Expect = 1.1e-18 Identity = 47/78 (60.26%), Postives = 58/78 (74.36%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|