
MC04g1463 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTCGGAAGGAAGAGTTCGAAGTATACGTTGGAGGATTGTCGTGGTGCATATCGGAGCGAGAGCTCCAAGATGCCTTCAGCCGTTTCGGAAGAATTATCGATACTCGGGTAACATTTCGTATTTTTGTCATTTTTCCGTGC ATGGCTCGGAAGGAAGAGTTCGAAGTATACGTTGGAGGATTGTCGTGGTGCATATCGGAGCGAGAGCTCCAAGATGCCTTCAGCCGTTTCGGAAGAATTATCGATACTCGGGTAACATTTCGTATTTTTGTCATTTTTCCGTGC ATGGCTCGGAAGGAAGAGTTCGAAGTATACGTTGGAGGATTGTCGTGGTGCATATCGGAGCGAGAGCTCCAAGATGCCTTCAGCCGTTTCGGAAGAATTATCGATACTCGGGTAACATTTCGTATTTTTGTCATTTTTCCGTGC MARKEEFEVYVGGLSWCISERELQDAFSRFGRIIDTRVTFRIFVIFPC Homology
BLAST of MC04g1463 vs. ExPASy Swiss-Prot
Match: Q14103 (Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD PE=1 SV=1) HSP 1 Score: 45.8 bits (107), Expect = 1.6e-04 Identity = 15/34 (44.12%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of MC04g1463 vs. ExPASy Swiss-Prot
Match: Q60668 (Heterogeneous nuclear ribonucleoprotein D0 OS=Mus musculus OX=10090 GN=Hnrnpd PE=1 SV=2) HSP 1 Score: 45.8 bits (107), Expect = 1.6e-04 Identity = 15/34 (44.12%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of MC04g1463 vs. ExPASy Swiss-Prot
Match: Q9JJ54 (Heterogeneous nuclear ribonucleoprotein D0 OS=Rattus norvegicus OX=10116 GN=Hnrnpd PE=1 SV=2) HSP 1 Score: 45.1 bits (105), Expect = 2.7e-04 Identity = 15/34 (44.12%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of MC04g1463 vs. ExPASy Swiss-Prot
Match: P49311 (Glycine-rich RNA-binding protein GRP2A OS=Sinapis alba OX=3728 PE=2 SV=1) HSP 1 Score: 44.3 bits (103), Expect = 4.6e-04 Identity = 15/33 (45.45%), Postives = 25/33 (75.76%), Query Frame = 0
BLAST of MC04g1463 vs. NCBI nr
Match: XP_022133548.1 (glycine-rich RNA-binding protein RZ1C-like [Momordica charantia]) HSP 1 Score: 80.5 bits (197), Expect = 1.02e-17 Identity = 38/38 (100.00%), Postives = 38/38 (100.00%), Query Frame = 0
BLAST of MC04g1463 vs. NCBI nr
Match: XP_023544240.1 (glycine-rich RNA-binding protein RZ1C [Cucurbita pepo subsp. pepo] >XP_023544248.1 glycine-rich RNA-binding protein RZ1C [Cucurbita pepo subsp. pepo]) HSP 1 Score: 58.2 bits (139), Expect = 3.31e-08 Identity = 23/38 (60.53%), Postives = 35/38 (92.11%), Query Frame = 0
BLAST of MC04g1463 vs. NCBI nr
Match: XP_022990423.1 (glycine-rich RNA-binding protein RZ1C [Cucurbita maxima] >XP_022990424.1 glycine-rich RNA-binding protein RZ1C [Cucurbita maxima]) HSP 1 Score: 58.2 bits (139), Expect = 3.31e-08 Identity = 23/38 (60.53%), Postives = 35/38 (92.11%), Query Frame = 0
BLAST of MC04g1463 vs. NCBI nr
Match: KAG6602289.1 (Glycine-rich RNA-binding protein RZ1C, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 58.2 bits (139), Expect = 3.31e-08 Identity = 23/38 (60.53%), Postives = 35/38 (92.11%), Query Frame = 0
BLAST of MC04g1463 vs. NCBI nr
Match: XP_022961758.1 (glycine-rich RNA-binding protein RZ1C-like [Cucurbita moschata] >XP_022961766.1 glycine-rich RNA-binding protein RZ1C-like [Cucurbita moschata]) HSP 1 Score: 58.2 bits (139), Expect = 3.31e-08 Identity = 23/38 (60.53%), Postives = 35/38 (92.11%), Query Frame = 0
BLAST of MC04g1463 vs. ExPASy TrEMBL
Match: A0A6J1BZF5 (glycine-rich RNA-binding protein RZ1C-like OS=Momordica charantia OX=3673 GN=LOC111006107 PE=4 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 4.95e-18 Identity = 38/38 (100.00%), Postives = 38/38 (100.00%), Query Frame = 0
BLAST of MC04g1463 vs. ExPASy TrEMBL
Match: A0A6J1JS04 (glycine-rich RNA-binding protein RZ1C OS=Cucurbita maxima OX=3661 GN=LOC111487287 PE=4 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 1.60e-08 Identity = 23/38 (60.53%), Postives = 35/38 (92.11%), Query Frame = 0
BLAST of MC04g1463 vs. ExPASy TrEMBL
Match: A0A6J1HB93 (glycine-rich RNA-binding protein RZ1C-like OS=Cucurbita moschata OX=3662 GN=LOC111462429 PE=4 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 1.60e-08 Identity = 23/38 (60.53%), Postives = 35/38 (92.11%), Query Frame = 0
BLAST of MC04g1463 vs. ExPASy TrEMBL
Match: A0A6J1CFE7 (glycine-rich RNA-binding protein RZ1C-like isoform X1 OS=Momordica charantia OX=3673 GN=LOC111010282 PE=4 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 4.34e-08 Identity = 23/38 (60.53%), Postives = 35/38 (92.11%), Query Frame = 0
BLAST of MC04g1463 vs. ExPASy TrEMBL
Match: A0A6J1BW89 (glycine-rich RNA-binding protein RZ1C-like isoform X1 OS=Momordica charantia OX=3673 GN=LOC111006270 PE=4 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 7.83e-08 Identity = 22/38 (57.89%), Postives = 35/38 (92.11%), Query Frame = 0
BLAST of MC04g1463 vs. TAIR 10
Match: AT3G08000.1 (RNA-binding (RRM/RBD/RNP motifs) family protein ) HSP 1 Score: 43.5 bits (101), Expect = 5.5e-05 Identity = 14/33 (42.42%), Postives = 25/33 (75.76%), Query Frame = 0
BLAST of MC04g1463 vs. TAIR 10
Match: AT5G04280.1 (RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain ) HSP 1 Score: 43.1 bits (100), Expect = 7.2e-05 Identity = 19/38 (50.00%), Postives = 29/38 (76.32%), Query Frame = 0
BLAST of MC04g1463 vs. TAIR 10
Match: AT3G26420.1 (RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain ) HSP 1 Score: 42.7 bits (99), Expect = 9.4e-05 Identity = 15/43 (34.88%), Postives = 28/43 (65.12%), Query Frame = 0
BLAST of MC04g1463 vs. TAIR 10
Match: AT1G60650.1 (RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain ) HSP 1 Score: 41.6 bits (96), Expect = 2.1e-04 Identity = 14/33 (42.42%), Postives = 25/33 (75.76%), Query Frame = 0
BLAST of MC04g1463 vs. TAIR 10
Match: AT1G60650.2 (RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain ) HSP 1 Score: 41.6 bits (96), Expect = 2.1e-04 Identity = 14/33 (42.42%), Postives = 25/33 (75.76%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|