MC04g1131 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATTTGTTGTGATGGTTGCAAGAGGAAAGTGAGAAAGGCACTGCATAGCATTGAAGGTACAAAAATTTTCAGGTTGTTCTTAATTATCTTATAAAAAATTATGCAAATTTTTCAGCTTTTTTTTTTAATTTTTAAAAACCCATTTTTGTTTTTGAATTTTCAGGTGTTTTGAGAATAGAAATTGACCCACTACAGCCAAAAGTGAGCATTTTTGGTAATGTTGACCCCCAAATTCTCATAAAGAAGCTTCATAAAGCTGGAAAACAAGCACAAATTTGGAGCCAAGGCAATAACAATTTCAATCAAATTAATTAC ATTTGTTGTGATGGTTGCAAGAGGAAAGTGAGAAAGGCACTGCATAGCATTGAAGGTGTTTTGAGAATAGAAATTGACCCACTACAGCCAAAAGTGAGCATTTTTGGTAATGTTGACCCCCAAATTCTCATAAAGAAGCTTCATAAAGCTGGAAAACAAGCACAAATTTGGAGCCAAGGCAATAACAATTTCAATCAAATTAATTAC ATTTGTTGTGATGGTTGCAAGAGGAAAGTGAGAAAGGCACTGCATAGCATTGAAGGTGTTTTGAGAATAGAAATTGACCCACTACAGCCAAAAGTGAGCATTTTTGGTAATGTTGACCCCCAAATTCTCATAAAGAAGCTTCATAAAGCTGGAAAACAAGCACAAATTTGGAGCCAAGGCAATAACAATTTCAATCAAATTAATTAC ICCDGCKRKVRKALHSIEGVLRIEIDPLQPKVSIFGNVDPQILIKKLHKAGKQAQIWSQGNNNFNQINY Homology
BLAST of MC04g1131 vs. ExPASy Swiss-Prot
Match: Q9M8K5 (Heavy metal-associated isoprenylated plant protein 32 OS=Arabidopsis thaliana OX=3702 GN=HIPP32 PE=2 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 3.7e-15 Identity = 40/68 (58.82%), Postives = 50/68 (73.53%), Query Frame = 0
BLAST of MC04g1131 vs. ExPASy Swiss-Prot
Match: F4JZL7 (Heavy metal-associated isoprenylated plant protein 33 OS=Arabidopsis thaliana OX=3702 GN=HIPP33 PE=2 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 4.1e-14 Identity = 40/72 (55.56%), Postives = 48/72 (66.67%), Query Frame = 0
BLAST of MC04g1131 vs. ExPASy Swiss-Prot
Match: Q84J88 (Heavy metal-associated isoprenylated plant protein 36 OS=Arabidopsis thaliana OX=3702 GN=HIPP36 PE=1 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 5.4e-14 Identity = 37/71 (52.11%), Postives = 49/71 (69.01%), Query Frame = 0
BLAST of MC04g1131 vs. ExPASy Swiss-Prot
Match: Q9C7J6 (Heavy metal-associated isoprenylated plant protein 35 OS=Arabidopsis thaliana OX=3702 GN=HIPP35 PE=2 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 2.3e-12 Identity = 32/55 (58.18%), Postives = 44/55 (80.00%), Query Frame = 0
BLAST of MC04g1131 vs. ExPASy Swiss-Prot
Match: Q0WV37 (Heavy metal-associated isoprenylated plant protein 34 OS=Arabidopsis thaliana OX=3702 GN=HIPP34 PE=2 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 3.3e-11 Identity = 29/58 (50.00%), Postives = 41/58 (70.69%), Query Frame = 0
BLAST of MC04g1131 vs. NCBI nr
Match: XP_021657893.1 (heavy metal-associated isoprenylated plant protein 35-like [Hevea brasiliensis] >KAF2323011.1 hypothetical protein GH714_032740 [Hevea brasiliensis]) HSP 1 Score: 108 bits (269), Expect = 6.13e-27 Identity = 48/63 (76.19%), Postives = 57/63 (90.48%), Query Frame = 0
BLAST of MC04g1131 vs. NCBI nr
Match: XP_034708189.1 (heavy metal-associated isoprenylated plant protein 32-like [Vitis riparia]) HSP 1 Score: 108 bits (269), Expect = 6.26e-27 Identity = 48/62 (77.42%), Postives = 54/62 (87.10%), Query Frame = 0
BLAST of MC04g1131 vs. NCBI nr
Match: KAG8656111.1 (hypothetical protein MANES_04G096100v8 [Manihot esculenta]) HSP 1 Score: 107 bits (266), Expect = 1.72e-26 Identity = 48/63 (76.19%), Postives = 56/63 (88.89%), Query Frame = 0
BLAST of MC04g1131 vs. NCBI nr
Match: RVW45064.1 (Heavy metal-associated isoprenylated plant protein 32 [Vitis vinifera]) HSP 1 Score: 107 bits (266), Expect = 1.75e-26 Identity = 47/62 (75.81%), Postives = 54/62 (87.10%), Query Frame = 0
BLAST of MC04g1131 vs. NCBI nr
Match: XP_021610893.1 (heavy metal-associated isoprenylated plant protein 35-like [Manihot esculenta] >OAY52599.1 hypothetical protein MANES_04G096100v8 [Manihot esculenta]) HSP 1 Score: 107 bits (266), Expect = 1.75e-26 Identity = 48/63 (76.19%), Postives = 56/63 (88.89%), Query Frame = 0
BLAST of MC04g1131 vs. ExPASy TrEMBL
Match: A0A6A6NA12 (HMA domain-containing protein OS=Hevea brasiliensis OX=3981 GN=GH714_032740 PE=4 SV=1) HSP 1 Score: 108 bits (269), Expect = 2.97e-27 Identity = 48/63 (76.19%), Postives = 57/63 (90.48%), Query Frame = 0
BLAST of MC04g1131 vs. ExPASy TrEMBL
Match: D7SVD6 (HMA domain-containing protein OS=Vitis vinifera OX=29760 GN=VIT_14s0068g00670 PE=4 SV=1) HSP 1 Score: 107 bits (266), Expect = 8.49e-27 Identity = 47/62 (75.81%), Postives = 54/62 (87.10%), Query Frame = 0
BLAST of MC04g1131 vs. ExPASy TrEMBL
Match: A0A438EBL1 (Heavy metal-associated isoprenylated plant protein 32 OS=Vitis vinifera OX=29760 GN=HIPP32_5 PE=4 SV=1) HSP 1 Score: 107 bits (266), Expect = 8.49e-27 Identity = 47/62 (75.81%), Postives = 54/62 (87.10%), Query Frame = 0
BLAST of MC04g1131 vs. ExPASy TrEMBL
Match: A0A2C9W139 (HMA domain-containing protein OS=Manihot esculenta OX=3983 GN=MANES_04G096100 PE=4 SV=1) HSP 1 Score: 107 bits (266), Expect = 8.49e-27 Identity = 48/63 (76.19%), Postives = 56/63 (88.89%), Query Frame = 0
BLAST of MC04g1131 vs. ExPASy TrEMBL
Match: A0A6N2M8L5 (HMA domain-containing protein OS=Salix viminalis OX=40686 GN=SVIM_LOCUS336591 PE=4 SV=1) HSP 1 Score: 104 bits (260), Expect = 4.73e-26 Identity = 45/62 (72.58%), Postives = 53/62 (85.48%), Query Frame = 0
BLAST of MC04g1131 vs. TAIR 10
Match: AT3G06130.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 81.6 bits (200), Expect = 2.6e-16 Identity = 40/68 (58.82%), Postives = 50/68 (73.53%), Query Frame = 0
BLAST of MC04g1131 vs. TAIR 10
Match: AT3G06130.2 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 81.6 bits (200), Expect = 2.6e-16 Identity = 40/68 (58.82%), Postives = 50/68 (73.53%), Query Frame = 0
BLAST of MC04g1131 vs. TAIR 10
Match: AT5G19090.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 78.2 bits (191), Expect = 2.9e-15 Identity = 40/72 (55.56%), Postives = 48/72 (66.67%), Query Frame = 0
BLAST of MC04g1131 vs. TAIR 10
Match: AT5G19090.2 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 78.2 bits (191), Expect = 2.9e-15 Identity = 40/72 (55.56%), Postives = 48/72 (66.67%), Query Frame = 0
BLAST of MC04g1131 vs. TAIR 10
Match: AT5G19090.3 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 78.2 bits (191), Expect = 2.9e-15 Identity = 40/72 (55.56%), Postives = 48/72 (66.67%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|