MC04g0905 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTAGACCATAAAGAAGCTATCATATCCCATTTAAGTTGGGCCAGCCTTTTTCTGGGGTTCCATACTTTGGGGCTTTATGTTCATAATGATGTCATGCTTGCTTTTGGTACTCCGGAGAAACAAATCTTAATCGAACCCATATTTGCCCAATGGATTCAATCTGCTCAT ATGTTAGACCATAAAGAAGCTATCATATCCCATTTAAGTTGGGCCAGCCTTTTTCTGGGGTTCCATACTTTGGGGCTTTATGTTCATAATGATGTCATGCTTGCTTTTGGTACTCCGGAGAAACAAATCTTAATCGAACCCATATTTGCCCAATGGATTCAATCTGCTCAT ATGTTAGACCATAAAGAAGCTATCATATCCCATTTAAGTTGGGCCAGCCTTTTTCTGGGGTTCCATACTTTGGGGCTTTATGTTCATAATGATGTCATGCTTGCTTTTGGTACTCCGGAGAAACAAATCTTAATCGAACCCATATTTGCCCAATGGATTCAATCTGCTCAT MLDHKEAIISHLSWASLFLGFHTLGLYVHNDVMLAFGTPEKQILIEPIFAQWIQSAH Homology
BLAST of MC04g0905 vs. ExPASy Swiss-Prot
Match: Q3V535 (Photosystem I P700 chlorophyll a apoprotein A2 OS=Acorus calamus OX=4465 GN=psaB PE=3 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 1.6e-27 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 0
BLAST of MC04g0905 vs. ExPASy Swiss-Prot
Match: A4QJB4 (Photosystem I P700 chlorophyll a apoprotein A2 OS=Aethionema cordifolium OX=434059 GN=psaB PE=3 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 1.6e-27 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 0
BLAST of MC04g0905 vs. ExPASy Swiss-Prot
Match: A4QJJ8 (Photosystem I P700 chlorophyll a apoprotein A2 OS=Aethionema grandiflorum OX=72657 GN=psaB PE=3 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 1.6e-27 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 0
BLAST of MC04g0905 vs. ExPASy Swiss-Prot
Match: A1EA07 (Photosystem I P700 chlorophyll a apoprotein A2 OS=Agrostis stolonifera OX=63632 GN=psaB PE=3 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 1.6e-27 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 0
BLAST of MC04g0905 vs. ExPASy Swiss-Prot
Match: Q33332 (Photosystem I P700 chlorophyll a apoprotein A2 OS=Antirrhinum majus OX=4151 GN=psaB PE=3 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 1.6e-27 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 0
BLAST of MC04g0905 vs. NCBI nr
Match: KJB10022.1 (hypothetical protein B456_001G180600, partial [Gossypium raimondii]) HSP 1 Score: 122 bits (305), Expect = 1.83e-34 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 0
BLAST of MC04g0905 vs. NCBI nr
Match: OMP13198.1 (Photosystem I PsaA/PsaB [Corchorus olitorius]) HSP 1 Score: 122 bits (305), Expect = 3.41e-34 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 0
BLAST of MC04g0905 vs. NCBI nr
Match: VDD65349.1 (unnamed protein product [Brassica oleracea]) HSP 1 Score: 122 bits (305), Expect = 6.16e-34 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 0
BLAST of MC04g0905 vs. NCBI nr
Match: VDD24445.1 (unnamed protein product [Brassica rapa]) HSP 1 Score: 122 bits (305), Expect = 7.13e-34 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 0
BLAST of MC04g0905 vs. NCBI nr
Match: VDD65627.1 (unnamed protein product [Brassica oleracea]) HSP 1 Score: 122 bits (305), Expect = 1.27e-33 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 0
BLAST of MC04g0905 vs. ExPASy TrEMBL
Match: A0A1J3JDJ4 (Uncharacterized protein (Fragment) OS=Noccaea caerulescens OX=107243 GN=MP_TR8487_c0_g1_i1_g.26888 PE=4 SV=1) HSP 1 Score: 122 bits (305), Expect = 6.44e-35 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 0
BLAST of MC04g0905 vs. ExPASy TrEMBL
Match: A0A0D2M066 (Uncharacterized protein (Fragment) OS=Gossypium raimondii OX=29730 GN=B456_001G180600 PE=4 SV=1) HSP 1 Score: 122 bits (305), Expect = 8.87e-35 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 0
BLAST of MC04g0905 vs. ExPASy TrEMBL
Match: A0A1R3L1N9 (Photosystem I PsaA/PsaB OS=Corchorus olitorius OX=93759 GN=COLO4_02099 PE=4 SV=1) HSP 1 Score: 122 bits (305), Expect = 1.65e-34 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 0
BLAST of MC04g0905 vs. ExPASy TrEMBL
Match: A0A453SG27 (Uncharacterized protein OS=Aegilops tauschii subsp. strangulata OX=200361 PE=4 SV=1) HSP 1 Score: 121 bits (303), Expect = 2.79e-34 Identity = 56/57 (98.25%), Postives = 57/57 (100.00%), Query Frame = 0
BLAST of MC04g0905 vs. ExPASy TrEMBL
Match: A0A3P6HHE4 (Uncharacterized protein OS=Brassica oleracea OX=3712 GN=BOLSC29T60577H PE=4 SV=1) HSP 1 Score: 122 bits (305), Expect = 2.98e-34 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 0
BLAST of MC04g0905 vs. TAIR 10
Match: ATCG00340.1 (Photosystem I, PsaA/PsaB protein ) HSP 1 Score: 122.5 bits (306), Expect = 1.1e-28 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 0
BLAST of MC04g0905 vs. TAIR 10
Match: ATCG00350.1 (Photosystem I, PsaA/PsaB protein ) HSP 1 Score: 79.3 bits (194), Expect = 1.1e-15 Identity = 33/62 (53.23%), Postives = 45/62 (72.58%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|