![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MC04g0634 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GACTACAAGTCGAAGAAGTGCATCGGGGGCGAGTGTCGCCATTTCAAGGCTTTGGTGTGGAGGGACACCGAATCCATTGGTTGTGCAATGGTGAACTGCAGAAAATATTTAGGGTTTGTCACCTGTAACTACTATCCTCCCGTTGGG GACTACAAGTCGAAGAAGTGCATCGGGGGCGAGTGTCGCCATTTCAAGGCTTTGGTGTGGAGGGACACCGAATCCATTGGTTGTGCAATGGTGAACTGCAGAAAATATTTAGGGTTTGTCACCTGTAACTACTATCCTCCCGTTGGG GACTACAAGTCGAAGAAGTGCATCGGGGGCGAGTGTCGCCATTTCAAGGCTTTGGTGTGGAGGGACACCGAATCCATTGGTTGTGCAATGGTGAACTGCAGAAAATATTTAGGGTTTGTCACCTGTAACTACTATCCTCCCGTTGGG DYKSKKCIGGECRHFKALVWRDTESIGCAMVNCRKYLGFVTCNYYPPVG Homology
BLAST of MC04g0634 vs. ExPASy Swiss-Prot
Match: P11670 (Basic form of pathogenesis-related protein 1 OS=Nicotiana tabacum OX=4097 PE=3 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 6.3e-09 Identity = 22/47 (46.81%), Postives = 29/47 (61.70%), Query Frame = 0
BLAST of MC04g0634 vs. ExPASy Swiss-Prot
Match: Q08697 (Pathogenesis-related protein 1A1 OS=Solanum lycopersicum OX=4081 PE=2 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 2.6e-07 Identity = 22/48 (45.83%), Postives = 28/48 (58.33%), Query Frame = 0
BLAST of MC04g0634 vs. ExPASy Swiss-Prot
Match: P04284 (Pathogenesis-related leaf protein 6 OS=Solanum lycopersicum OX=4081 GN=PR1B1 PE=1 SV=2) HSP 1 Score: 53.1 bits (126), Expect = 1.0e-06 Identity = 18/47 (38.30%), Postives = 30/47 (63.83%), Query Frame = 0
BLAST of MC04g0634 vs. ExPASy Swiss-Prot
Match: Q00008 (Pathogenesis-related protein PRMS OS=Zea mays OX=4577 GN=PRMS PE=2 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 2.9e-06 Identity = 23/48 (47.92%), Postives = 29/48 (60.42%), Query Frame = 0
BLAST of MC04g0634 vs. ExPASy Swiss-Prot
Match: Q41359 (Pathogenesis-related protein PR-1 type OS=Sambucus nigra OX=4202 PE=2 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 3.8e-06 Identity = 19/39 (48.72%), Postives = 24/39 (61.54%), Query Frame = 0
BLAST of MC04g0634 vs. NCBI nr
Match: XP_022148738.1 (pathogenesis-related leaf protein 4-like [Momordica charantia]) HSP 1 Score: 102 bits (254), Expect = 1.26e-25 Identity = 40/49 (81.63%), Postives = 45/49 (91.84%), Query Frame = 0
BLAST of MC04g0634 vs. NCBI nr
Match: KAE8008203.1 (hypothetical protein FH972_004740 [Carpinus fangiana]) HSP 1 Score: 76.6 bits (187), Expect = 3.92e-16 Identity = 30/47 (63.83%), Postives = 33/47 (70.21%), Query Frame = 0
BLAST of MC04g0634 vs. NCBI nr
Match: KAE8008201.1 (hypothetical protein FH972_004738 [Carpinus fangiana] >KAE8008202.1 hypothetical protein FH972_004739 [Carpinus fangiana]) HSP 1 Score: 76.6 bits (187), Expect = 6.83e-16 Identity = 30/47 (63.83%), Postives = 33/47 (70.21%), Query Frame = 0
BLAST of MC04g0634 vs. NCBI nr
Match: KAE8008204.1 (hypothetical protein FH972_004741 [Carpinus fangiana]) HSP 1 Score: 76.3 bits (186), Expect = 9.65e-16 Identity = 29/47 (61.70%), Postives = 33/47 (70.21%), Query Frame = 0
BLAST of MC04g0634 vs. NCBI nr
Match: XP_022148824.1 (basic form of pathogenesis-related protein 1-like [Momordica charantia] >XP_022158626.1 basic form of pathogenesis-related protein 1-like [Momordica charantia]) HSP 1 Score: 75.9 bits (185), Expect = 1.25e-15 Identity = 28/46 (60.87%), Postives = 36/46 (78.26%), Query Frame = 0
BLAST of MC04g0634 vs. ExPASy TrEMBL
Match: A0A6J1D4Y0 (pathogenesis-related leaf protein 4-like OS=Momordica charantia OX=3673 GN=LOC111017330 PE=4 SV=1) HSP 1 Score: 102 bits (254), Expect = 6.09e-26 Identity = 40/49 (81.63%), Postives = 45/49 (91.84%), Query Frame = 0
BLAST of MC04g0634 vs. ExPASy TrEMBL
Match: A0A5N6QPZ5 (SCP domain-containing protein OS=Carpinus fangiana OX=176857 GN=FH972_004740 PE=4 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.90e-16 Identity = 30/47 (63.83%), Postives = 33/47 (70.21%), Query Frame = 0
BLAST of MC04g0634 vs. ExPASy TrEMBL
Match: A0A5N6QM26 (SCP domain-containing protein OS=Carpinus fangiana OX=176857 GN=FH972_004738 PE=4 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 3.31e-16 Identity = 30/47 (63.83%), Postives = 33/47 (70.21%), Query Frame = 0
BLAST of MC04g0634 vs. ExPASy TrEMBL
Match: A0A5N6QMG1 (SCP domain-containing protein OS=Carpinus fangiana OX=176857 GN=FH972_004741 PE=4 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 4.67e-16 Identity = 29/47 (61.70%), Postives = 33/47 (70.21%), Query Frame = 0
BLAST of MC04g0634 vs. ExPASy TrEMBL
Match: A0A6J1D549 (basic form of pathogenesis-related protein 1-like OS=Momordica charantia OX=3673 GN=LOC111017384 PE=4 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 6.05e-16 Identity = 28/46 (60.87%), Postives = 36/46 (78.26%), Query Frame = 0
BLAST of MC04g0634 vs. TAIR 10
Match: AT5G26130.1 (CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein ) HSP 1 Score: 57.8 bits (138), Expect = 2.9e-09 Identity = 24/47 (51.06%), Postives = 29/47 (61.70%), Query Frame = 0
BLAST of MC04g0634 vs. TAIR 10
Match: AT4G33720.1 (CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein ) HSP 1 Score: 56.2 bits (134), Expect = 8.4e-09 Identity = 22/48 (45.83%), Postives = 29/48 (60.42%), Query Frame = 0
BLAST of MC04g0634 vs. TAIR 10
Match: AT3G19690.1 (CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein ) HSP 1 Score: 55.1 bits (131), Expect = 1.9e-08 Identity = 23/50 (46.00%), Postives = 29/50 (58.00%), Query Frame = 0
BLAST of MC04g0634 vs. TAIR 10
Match: AT1G50060.1 (CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein ) HSP 1 Score: 53.9 bits (128), Expect = 4.2e-08 Identity = 22/47 (46.81%), Postives = 27/47 (57.45%), Query Frame = 0
BLAST of MC04g0634 vs. TAIR 10
Match: AT4G33710.1 (CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein ) HSP 1 Score: 50.8 bits (120), Expect = 3.5e-07 Identity = 21/47 (44.68%), Postives = 29/47 (61.70%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|