
MC04g0436 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGATGATGCAGTGGTGCGGCGCAGTAGCTAGGCGAGTGATGGCGACGGAGCGGCGCGCTCCTTCACTAACGTCACCAATGGCGGCCGAAGCTCTGGTGCCGATCCTGTGTGGACGAGGTGACAAGAAGACCAAAAAGGGGAAGAGATTCAAAGGCTCCTACGGCAACGCCAGGCCGAAGAAGGAGAAGAAGATTCAGCGCATCAAGGATAAAATCGAGGTTCCTAGTTCCACTCCTTGGCCTCTTCCTTTCAAGCTCATC ATGGCGATGATGCAGTGGTGCGGCGCAGTAGCTAGGCGAGTGATGGCGACGGAGCGGCGCGCTCCTTCACTAACGTCACCAATGGCGGCCGAAGCTCTGGTGCCGATCCTGTGTGGACGAGGTGACAAGAAGACCAAAAAGGGGAAGAGATTCAAAGGCTCCTACGGCAACGCCAGGCCGAAGAAGGAGAAGAAGATTCAGCGCATCAAGGATAAAATCGAGGTTCCTAGTTCCACTCCTTGGCCTCTTCCTTTCAAGCTCATC ATGGCGATGATGCAGTGGTGCGGCGCAGTAGCTAGGCGAGTGATGGCGACGGAGCGGCGCGCTCCTTCACTAACGTCACCAATGGCGGCCGAAGCTCTGGTGCCGATCCTGTGTGGACGAGGTGACAAGAAGACCAAAAAGGGGAAGAGATTCAAAGGCTCCTACGGCAACGCCAGGCCGAAGAAGGAGAAGAAGATTCAGCGCATCAAGGATAAAATCGAGGTTCCTAGTTCCACTCCTTGGCCTCTTCCTTTCAAGCTCATC MAMMQWCGAVARRVMATERRAPSLTSPMAAEALVPILCGRGDKKTKKGKRFKGSYGNARPKKEKKIQRIKDKIEVPSSTPWPLPFKLI Homology
BLAST of MC04g0436 vs. ExPASy Swiss-Prot
Match: Q9SJU8 (30S ribosomal protein S31, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g21290 PE=1 SV=1) HSP 1 Score: 117.5 bits (293), Expect = 7.8e-26 Identity = 63/98 (64.29%), Postives = 74/98 (75.51%), Query Frame = 0
BLAST of MC04g0436 vs. ExPASy Swiss-Prot
Match: P47909 (30S ribosomal protein S31, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=Os09g0528100 PE=3 SV=2) HSP 1 Score: 102.8 bits (255), Expect = 2.0e-21 Identity = 48/70 (68.57%), Postives = 57/70 (81.43%), Query Frame = 0
BLAST of MC04g0436 vs. ExPASy Swiss-Prot
Match: P47910 (30S ribosomal protein S31, chloroplastic OS=Spinacia oleracea OX=3562 GN=RPS31 PE=1 SV=2) HSP 1 Score: 48.9 bits (115), Expect = 3.4e-05 Identity = 24/44 (54.55%), Postives = 33/44 (75.00%), Query Frame = 0
BLAST of MC04g0436 vs. ExPASy Swiss-Prot
Match: O80439 (30S ribosomal protein S31, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPS31 PE=1 SV=1) HSP 1 Score: 47.8 bits (112), Expect = 7.6e-05 Identity = 24/55 (43.64%), Postives = 37/55 (67.27%), Query Frame = 0
BLAST of MC04g0436 vs. NCBI nr
Match: XP_022136007.1 (30S ribosomal protein S31, mitochondrial [Momordica charantia]) HSP 1 Score: 174 bits (441), Expect = 1.01e-54 Identity = 88/88 (100.00%), Postives = 88/88 (100.00%), Query Frame = 0
BLAST of MC04g0436 vs. NCBI nr
Match: XP_022933003.1 (30S ribosomal protein S31, mitochondrial [Cucurbita moschata] >XP_023529502.1 30S ribosomal protein S31, mitochondrial isoform X1 [Cucurbita pepo subsp. pepo] >XP_023529503.1 30S ribosomal protein S31, mitochondrial isoform X2 [Cucurbita pepo subsp. pepo] >KAG6588415.1 30S ribosomal protein S31, mitochondrial, partial [Cucurbita argyrosperma subsp. sororia] >KAG7022258.1 30S ribosomal protein S31, mitochondrial, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 159 bits (402), Expect = 8.99e-49 Identity = 81/88 (92.05%), Postives = 82/88 (93.18%), Query Frame = 0
BLAST of MC04g0436 vs. NCBI nr
Match: XP_038888313.1 (30S ribosomal protein S31, mitochondrial [Benincasa hispida]) HSP 1 Score: 155 bits (392), Expect = 3.02e-47 Identity = 80/88 (90.91%), Postives = 82/88 (93.18%), Query Frame = 0
BLAST of MC04g0436 vs. NCBI nr
Match: XP_022952601.1 (30S ribosomal protein S31, mitochondrial-like [Cucurbita moschata]) HSP 1 Score: 154 bits (390), Expect = 5.74e-47 Identity = 77/86 (89.53%), Postives = 80/86 (93.02%), Query Frame = 0
BLAST of MC04g0436 vs. NCBI nr
Match: XP_008448047.1 (PREDICTED: 30S ribosomal protein S31, mitochondrial [Cucumis melo] >KAA0033759.1 30S ribosomal protein S31 [Cucumis melo var. makuwa] >TYK22378.1 30S ribosomal protein S31 [Cucumis melo var. makuwa]) HSP 1 Score: 154 bits (389), Expect = 8.65e-47 Identity = 77/88 (87.50%), Postives = 81/88 (92.05%), Query Frame = 0
BLAST of MC04g0436 vs. ExPASy TrEMBL
Match: A0A6J1C4C8 (30S ribosomal protein S31, mitochondrial OS=Momordica charantia OX=3673 GN=LOC111007814 PE=3 SV=1) HSP 1 Score: 174 bits (441), Expect = 4.87e-55 Identity = 88/88 (100.00%), Postives = 88/88 (100.00%), Query Frame = 0
BLAST of MC04g0436 vs. ExPASy TrEMBL
Match: A0A6J1F3E9 (30S ribosomal protein S31, mitochondrial OS=Cucurbita moschata OX=3662 GN=LOC111439636 PE=3 SV=1) HSP 1 Score: 159 bits (402), Expect = 4.35e-49 Identity = 81/88 (92.05%), Postives = 82/88 (93.18%), Query Frame = 0
BLAST of MC04g0436 vs. ExPASy TrEMBL
Match: A0A6J1GKP4 (30S ribosomal protein S31, mitochondrial-like OS=Cucurbita moschata OX=3662 GN=LOC111455241 PE=3 SV=1) HSP 1 Score: 154 bits (390), Expect = 2.78e-47 Identity = 77/86 (89.53%), Postives = 80/86 (93.02%), Query Frame = 0
BLAST of MC04g0436 vs. ExPASy TrEMBL
Match: A0A5A7SX60 (30S ribosomal protein S31 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1428G001030 PE=3 SV=1) HSP 1 Score: 154 bits (389), Expect = 4.19e-47 Identity = 77/88 (87.50%), Postives = 81/88 (92.05%), Query Frame = 0
BLAST of MC04g0436 vs. ExPASy TrEMBL
Match: A0A1S3BI88 (30S ribosomal protein S31, mitochondrial OS=Cucumis melo OX=3656 GN=LOC103490344 PE=3 SV=1) HSP 1 Score: 154 bits (389), Expect = 4.19e-47 Identity = 77/88 (87.50%), Postives = 81/88 (92.05%), Query Frame = 0
BLAST of MC04g0436 vs. TAIR 10
Match: AT2G21290.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: mitochondrion; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; Has 63 Blast hits to 63 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 63; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 117.5 bits (293), Expect = 5.5e-27 Identity = 63/98 (64.29%), Postives = 74/98 (75.51%), Query Frame = 0
BLAST of MC04g0436 vs. TAIR 10
Match: AT2G38140.1 (plastid-specific ribosomal protein 4 ) HSP 1 Score: 47.8 bits (112), Expect = 5.4e-06 Identity = 24/55 (43.64%), Postives = 37/55 (67.27%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|