
MC03g0372 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TCCACTATCACCCCTAAAAAACCAAACTCTGTCTTACGTAAAGTTGCCAGAGTACGCTTAACCTCGGGATTTGAAATAACTACTTATATACCTGGTATTGGTCATAATTTACAAGAACATTATGTAGTCTTAATAAGAGGGGGAAGGGTTAAGGATTTACCCGGTGTGAGATATCAC TCCACTATCACCCCTAAAAAACCAAACTCTGTCTTACGTAAAGTTGCCAGAGTACGCTTAACCTCGGGATTTGAAATAACTACTTATATACCTGGTATTGGTCATAATTTACAAGAACATTATGTAGTCTTAATAAGAGGGGGAAGGGTTAAGGATTTACCCGGTGTGAGATATCAC TCCACTATCACCCCTAAAAAACCAAACTCTGTCTTACGTAAAGTTGCCAGAGTACGCTTAACCTCGGGATTTGAAATAACTACTTATATACCTGGTATTGGTCATAATTTACAAGAACATTATGTAGTCTTAATAAGAGGGGGAAGGGTTAAGGATTTACCCGGTGTGAGATATCAC STITPKKPNSVLRKVARVRLTSGFEITTYIPGIGHNLQEHYVVLIRGGRVKDLPGVRYH Homology
BLAST of MC03g0372 vs. ExPASy Swiss-Prot
Match: A4QJX7 (30S ribosomal protein S12-B, chloroplastic OS=Olimarabidopsis pumila OX=74718 GN=rps12-B PE=3 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 6.8e-26 Identity = 55/59 (93.22%), Postives = 56/59 (94.92%), Query Frame = 0
BLAST of MC03g0372 vs. ExPASy Swiss-Prot
Match: A4QJV5 (30S ribosomal protein S12-A, chloroplastic OS=Olimarabidopsis pumila OX=74718 GN=rps12-A PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 2.0e-25 Identity = 54/58 (93.10%), Postives = 55/58 (94.83%), Query Frame = 0
BLAST of MC03g0372 vs. ExPASy Swiss-Prot
Match: Q3V510 (30S ribosomal protein S12, chloroplastic OS=Acorus calamus OX=4465 GN=rps12-A PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 2.0e-25 Identity = 54/58 (93.10%), Postives = 55/58 (94.83%), Query Frame = 0
BLAST of MC03g0372 vs. ExPASy Swiss-Prot
Match: A4QJD9 (30S ribosomal protein S12, chloroplastic OS=Aethionema cordifolium OX=434059 GN=rps12-A PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 2.0e-25 Identity = 54/58 (93.10%), Postives = 55/58 (94.83%), Query Frame = 0
BLAST of MC03g0372 vs. ExPASy Swiss-Prot
Match: A4QJM3 (30S ribosomal protein S12, chloroplastic OS=Aethionema grandiflorum OX=72657 GN=rps12-A PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 2.0e-25 Identity = 54/58 (93.10%), Postives = 55/58 (94.83%), Query Frame = 0
BLAST of MC03g0372 vs. NCBI nr
Match: VVW89850.1 (unnamed protein product, partial [Nymphaea colorata]) HSP 1 Score: 117 bits (292), Expect = 1.11e-32 Identity = 55/59 (93.22%), Postives = 56/59 (94.92%), Query Frame = 0
BLAST of MC03g0372 vs. NCBI nr
Match: RWV89324.1 (hypothetical protein GW17_00048527, partial [Ensete ventricosum]) HSP 1 Score: 117 bits (292), Expect = 1.24e-32 Identity = 55/59 (93.22%), Postives = 56/59 (94.92%), Query Frame = 0
BLAST of MC03g0372 vs. NCBI nr
Match: KYP43640.1 (hypothetical protein KK1_034921, partial [Cajanus cajan] >KYP55165.1 hypothetical protein KK1_001372, partial [Cajanus cajan]) HSP 1 Score: 117 bits (292), Expect = 1.32e-32 Identity = 55/59 (93.22%), Postives = 56/59 (94.92%), Query Frame = 0
BLAST of MC03g0372 vs. NCBI nr
Match: CDI73623.1 (ribosomal protein S12, 3, partial [Pyrus spinosa]) HSP 1 Score: 117 bits (292), Expect = 1.61e-32 Identity = 55/59 (93.22%), Postives = 56/59 (94.92%), Query Frame = 0
BLAST of MC03g0372 vs. NCBI nr
Match: KYP38045.1 (hypothetical protein KK1_040718, partial [Cajanus cajan] >VVW90961.1 unnamed protein product, partial [Nymphaea colorata]) HSP 1 Score: 117 bits (292), Expect = 1.66e-32 Identity = 55/59 (93.22%), Postives = 56/59 (94.92%), Query Frame = 0
BLAST of MC03g0372 vs. ExPASy TrEMBL
Match: A0A5K1HM42 (Uncharacterized protein (Fragment) OS=Nymphaea colorata OX=210225 GN=NYM_LOCUS30506 PE=3 SV=1) HSP 1 Score: 117 bits (292), Expect = 5.38e-33 Identity = 55/59 (93.22%), Postives = 56/59 (94.92%), Query Frame = 0
BLAST of MC03g0372 vs. ExPASy TrEMBL
Match: A0A444CTW6 (Uncharacterized protein (Fragment) OS=Ensete ventricosum OX=4639 GN=GW17_00048527 PE=3 SV=1) HSP 1 Score: 117 bits (292), Expect = 6.02e-33 Identity = 55/59 (93.22%), Postives = 56/59 (94.92%), Query Frame = 0
BLAST of MC03g0372 vs. ExPASy TrEMBL
Match: A0A151RM35 (Uncharacterized protein (Fragment) OS=Cajanus cajan OX=3821 GN=KK1_001372 PE=3 SV=1) HSP 1 Score: 117 bits (292), Expect = 6.38e-33 Identity = 55/59 (93.22%), Postives = 56/59 (94.92%), Query Frame = 0
BLAST of MC03g0372 vs. ExPASy TrEMBL
Match: A0A287NDH3 (Uncharacterized protein OS=Hordeum vulgare subsp. vulgare OX=112509 PE=3 SV=1) HSP 1 Score: 117 bits (292), Expect = 6.75e-33 Identity = 55/59 (93.22%), Postives = 56/59 (94.92%), Query Frame = 0
BLAST of MC03g0372 vs. ExPASy TrEMBL
Match: V6BPW7 (Ribosomal protein S12, 3 (Fragment) OS=Pyrus spinosa OX=1143245 GN=rps12 PE=3 SV=1) HSP 1 Score: 117 bits (292), Expect = 7.80e-33 Identity = 55/59 (93.22%), Postives = 56/59 (94.92%), Query Frame = 0
BLAST of MC03g0372 vs. TAIR 10
Match: ATCG00065.1 (ribosomal protein S12A ) HSP 1 Score: 115.5 bits (288), Expect = 1.4e-26 Identity = 54/58 (93.10%), Postives = 55/58 (94.83%), Query Frame = 0
BLAST of MC03g0372 vs. TAIR 10
Match: ATCG01230.1 (ribosomal protein S12B ) HSP 1 Score: 115.5 bits (288), Expect = 1.4e-26 Identity = 54/58 (93.10%), Postives = 55/58 (94.83%), Query Frame = 0
BLAST of MC03g0372 vs. TAIR 10
Match: ATCG00905.1 (ribosomal protein S12C ) HSP 1 Score: 115.5 bits (288), Expect = 1.4e-26 Identity = 54/58 (93.10%), Postives = 55/58 (94.83%), Query Frame = 0
BLAST of MC03g0372 vs. TAIR 10
Match: AT2G07675.1 (Ribosomal protein S12/S23 family protein ) HSP 1 Score: 82.8 bits (203), Expect = 1.0e-16 Identity = 39/59 (66.10%), Postives = 46/59 (77.97%), Query Frame = 0
BLAST of MC03g0372 vs. TAIR 10
Match: ATMG00980.1 (Ribosomal protein S12/S23 family protein ) HSP 1 Score: 82.8 bits (203), Expect = 1.0e-16 Identity = 39/59 (66.10%), Postives = 46/59 (77.97%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|