MC03g0289 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAATTCTTTTCTGCTCCTCTGTTTCTGGTTGTCCTGCTTCCAGCAATGGTGGCAGCTGCCGCTCCCAGTCCCAGTCCCGTCTATCAGCCGAGTCAAGGCGGCCAATATGAGCCGATAAAAAATTTGAGTGACCCATACATTTCCGAAATCGGAAGGTATGCATGTATTGAGTACAACAGGAAATACCCGAGTCCTACACCACTTGTATTCCAGAAAGTGGTGAGTGGGGAAAAACAGGTGGTGAATGGATACAACTACAAGCTCATAATGTACATCAAAAGCGGCGGTCTAATTCCCCAGTATGAGGTCATCGTGTATGACATTCCATGGAAGAGCCACAGAGAACTTACGTCTTTA ATGAAATTCTTTTCTGCTCCTCTGTTTCTGGTTGTCCTGCTTCCAGCAATGGTGGCAGCTGCCGCTCCCAGTCCCAGTCCCGTCTATCAGCCGAGTCAAGGCGGCCAATATGAGCCGATAAAAAATTTGAGTGACCCATACATTTCCGAAATCGGAAGGTATGCATGTATTGAGTACAACAGGAAATACCCGAGTCCTACACCACTTGTATTCCAGAAAGTGGTGAGTGGGGAAAAACAGGTGGTGAATGGATACAACTACAAGCTCATAATGTACATCAAAAGCGGCGGTCTAATTCCCCAGTATGAGGTCATCGTGTATGACATTCCATGGAAGAGCCACAGAGAACTTACGTCTTTA ATGAAATTCTTTTCTGCTCCTCTGTTTCTGGTTGTCCTGCTTCCAGCAATGGTGGCAGCTGCCGCTCCCAGTCCCAGTCCCGTCTATCAGCCGAGTCAAGGCGGCCAATATGAGCCGATAAAAAATTTGAGTGACCCATACATTTCCGAAATCGGAAGGTATGCATGTATTGAGTACAACAGGAAATACCCGAGTCCTACACCACTTGTATTCCAGAAAGTGGTGAGTGGGGAAAAACAGGTGGTGAATGGATACAACTACAAGCTCATAATGTACATCAAAAGCGGCGGTCTAATTCCCCAGTATGAGGTCATCGTGTATGACATTCCATGGAAGAGCCACAGAGAACTTACGTCTTTA MKFFSAPLFLVVLLPAMVAAAAPSPSPVYQPSQGGQYEPIKNLSDPYISEIGRYACIEYNRKYPSPTPLVFQKVVSGEKQVVNGYNYKLIMYIKSGGLIPQYEVIVYDIPWKSHRELTSL Homology
BLAST of MC03g0289 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 78.6 bits (192), Expect = 5.5e-14 Identity = 48/111 (43.24%), Postives = 65/111 (58.56%), Query Frame = 0
BLAST of MC03g0289 vs. ExPASy Swiss-Prot
Match: Q10Q46 (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 3.9e-12 Identity = 45/109 (41.28%), Postives = 61/109 (55.96%), Query Frame = 0
BLAST of MC03g0289 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 68.2 bits (165), Expect = 7.4e-11 Identity = 39/113 (34.51%), Postives = 64/113 (56.64%), Query Frame = 0
BLAST of MC03g0289 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 4.8e-10 Identity = 37/113 (32.74%), Postives = 63/113 (55.75%), Query Frame = 0
BLAST of MC03g0289 vs. ExPASy Swiss-Prot
Match: Q10J94 (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.8e-09 Identity = 44/115 (38.26%), Postives = 66/115 (57.39%), Query Frame = 0
BLAST of MC03g0289 vs. NCBI nr
Match: XP_022156944.1 (cysteine proteinase inhibitor 5-like [Momordica charantia]) HSP 1 Score: 241 bits (616), Expect = 2.47e-80 Identity = 120/120 (100.00%), Postives = 120/120 (100.00%), Query Frame = 0
BLAST of MC03g0289 vs. NCBI nr
Match: XP_022147176.1 (cysteine proteinase inhibitor 1-like [Momordica charantia]) HSP 1 Score: 143 bits (360), Expect = 2.27e-40 Identity = 69/86 (80.23%), Postives = 75/86 (87.21%), Query Frame = 0
BLAST of MC03g0289 vs. NCBI nr
Match: XP_022156941.1 (cysteine proteinase inhibitor 5-like [Momordica charantia]) HSP 1 Score: 105 bits (263), Expect = 1.24e-26 Identity = 60/114 (52.63%), Postives = 73/114 (64.04%), Query Frame = 0
BLAST of MC03g0289 vs. NCBI nr
Match: XP_022156942.1 (cysteine proteinase inhibitor 1-like [Momordica charantia]) HSP 1 Score: 102 bits (253), Expect = 2.97e-25 Identity = 57/106 (53.77%), Postives = 69/106 (65.09%), Query Frame = 0
BLAST of MC03g0289 vs. NCBI nr
Match: XP_041025983.1 (LOW QUALITY PROTEIN: cysteine proteinase inhibitor 5 [Juglans microcarpa x Juglans regia]) HSP 1 Score: 87.8 bits (216), Expect = 1.41e-19 Identity = 47/106 (44.34%), Postives = 66/106 (62.26%), Query Frame = 0
BLAST of MC03g0289 vs. ExPASy TrEMBL
Match: A0A6J1DV34 (cysteine proteinase inhibitor 5-like OS=Momordica charantia OX=3673 GN=LOC111023777 PE=4 SV=1) HSP 1 Score: 241 bits (616), Expect = 1.20e-80 Identity = 120/120 (100.00%), Postives = 120/120 (100.00%), Query Frame = 0
BLAST of MC03g0289 vs. ExPASy TrEMBL
Match: A0A6J1D1J8 (cysteine proteinase inhibitor 1-like OS=Momordica charantia OX=3673 GN=LOC111016188 PE=4 SV=1) HSP 1 Score: 143 bits (360), Expect = 1.10e-40 Identity = 69/86 (80.23%), Postives = 75/86 (87.21%), Query Frame = 0
BLAST of MC03g0289 vs. ExPASy TrEMBL
Match: A0A6J1DWG9 (cysteine proteinase inhibitor 5-like OS=Momordica charantia OX=3673 GN=LOC111023773 PE=4 SV=1) HSP 1 Score: 105 bits (263), Expect = 5.99e-27 Identity = 60/114 (52.63%), Postives = 73/114 (64.04%), Query Frame = 0
BLAST of MC03g0289 vs. ExPASy TrEMBL
Match: A0A6J1DTA4 (cysteine proteinase inhibitor 1-like OS=Momordica charantia OX=3673 GN=LOC111023774 PE=4 SV=1) HSP 1 Score: 102 bits (253), Expect = 1.44e-25 Identity = 57/106 (53.77%), Postives = 69/106 (65.09%), Query Frame = 0
BLAST of MC03g0289 vs. ExPASy TrEMBL
Match: A0A2I4G446 (cysteine proteinase inhibitor 5 OS=Juglans regia OX=51240 GN=LOC109004561 PE=4 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 1.41e-19 Identity = 47/106 (44.34%), Postives = 67/106 (63.21%), Query Frame = 0
BLAST of MC03g0289 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 78.6 bits (192), Expect = 3.9e-15 Identity = 48/111 (43.24%), Postives = 65/111 (58.56%), Query Frame = 0
BLAST of MC03g0289 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 63.2 bits (152), Expect = 1.7e-10 Identity = 36/86 (41.86%), Postives = 49/86 (56.98%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|