MC02g_new0198 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGAGGGAAAGTTCCAGTGAAGGTGATAAAAGAGGCGGTTGCAGAGGCGCTGGTATTTTACTATCCTTTTGCAAGCAGATTAAGAGAAGAACATGGTAGGAAGTTGTTTGTAGACTGTACGGGCGAAGGAATCTTGTTCATCGAGGCAAATGCAGACGTGACTCTAGAACAATTCGATGATGCTCTTCAACCCCCATTTTCATGCTTGGATGAGCTTCTTTATGACATTCCAAGCTCTAATGGAATTCTTAATTGTTCATGA ATGGGAGGGAAAGTTCCAGTGAAGGTGATAAAAGAGGCGGTTGCAGAGGCGCTGGTATTTTACTATCCTTTTGCAAGCAGATTAAGAGAAGAACATGGTAGGAAGTTGTTTGTAGACTGTACGGGCGAAGGAATCTTGTTCATCGAGGCAAATGCAGACGTGACTCTAGAACAATTCGATGATGCTCTTCAACCCCCATTTTCATGCTTGGATGAGCTTCTTTATGACATTCCAAGCTCTAATGGAATTCTTAATTGTTCATGA ATGGGAGGGAAAGTTCCAGTGAAGGTGATAAAAGAGGCGGTTGCAGAGGCGCTGGTATTTTACTATCCTTTTGCAAGCAGATTAAGAGAAGAACATGGTAGGAAGTTGTTTGTAGACTGTACGGGCGAAGGAATCTTGTTCATCGAGGCAAATGCAGACGTGACTCTAGAACAATTCGATGATGCTCTTCAACCCCCATTTTCATGCTTGGATGAGCTTCTTTATGACATTCCAAGCTCTAATGGAATTCTTAATTGTTCATGA MGGKVPVKVIKEAVAEALVFYYPFASRLREEHGRKLFVDCTGEGILFIEANADVTLEQFDDALQPPFSCLDELLYDIPSSNGILNCS Homology
BLAST of MC02g_new0198 vs. ExPASy Swiss-Prot
Match: Q8GT20 (Benzyl alcohol O-benzoyltransferase OS=Nicotiana tabacum OX=4097 GN=HSR201 PE=1 SV=1) HSP 1 Score: 144.4 bits (363), Expect = 5.9e-34 Identity = 66/86 (76.74%), Postives = 75/86 (87.21%), Query Frame = 0
BLAST of MC02g_new0198 vs. ExPASy Swiss-Prot
Match: Q6E593 (Benzyl alcohol O-benzoyltransferase OS=Petunia hybrida OX=4102 GN=BEBT1 PE=1 SV=1) HSP 1 Score: 141.7 bits (356), Expect = 3.8e-33 Identity = 63/86 (73.26%), Postives = 75/86 (87.21%), Query Frame = 0
BLAST of MC02g_new0198 vs. ExPASy Swiss-Prot
Match: Q8GT21 (Benzyl alcohol O-benzoyltransferase OS=Clarkia breweri OX=36903 PE=1 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 4.4e-29 Identity = 57/80 (71.25%), Postives = 69/80 (86.25%), Query Frame = 0
BLAST of MC02g_new0198 vs. ExPASy Swiss-Prot
Match: Q5H873 (13-hydroxylupanine O-tigloyltransferase OS=Lupinus albus OX=3870 GN=HMT/HLT PE=1 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 2.0e-26 Identity = 54/85 (63.53%), Postives = 68/85 (80.00%), Query Frame = 0
BLAST of MC02g_new0198 vs. ExPASy Swiss-Prot
Match: Q3ZPN4 (Methanol O-anthraniloyltransferase OS=Vitis labrusca OX=103355 GN=AMAT PE=1 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 2.9e-25 Identity = 55/84 (65.48%), Postives = 64/84 (76.19%), Query Frame = 0
BLAST of MC02g_new0198 vs. NCBI nr
Match: MBA0844025.1 (hypothetical protein [Gossypium armourianum]) HSP 1 Score: 137 bits (345), Expect = 2.70e-39 Identity = 64/86 (74.42%), Postives = 75/86 (87.21%), Query Frame = 0
BLAST of MC02g_new0198 vs. NCBI nr
Match: MBA0752317.1 (hypothetical protein [Gossypium gossypioides]) HSP 1 Score: 137 bits (344), Expect = 4.73e-39 Identity = 64/86 (74.42%), Postives = 75/86 (87.21%), Query Frame = 0
BLAST of MC02g_new0198 vs. NCBI nr
Match: XP_022148522.1 (benzyl alcohol O-benzoyltransferase-like [Momordica charantia]) HSP 1 Score: 144 bits (363), Expect = 7.28e-39 Identity = 67/86 (77.91%), Postives = 77/86 (89.53%), Query Frame = 0
BLAST of MC02g_new0198 vs. NCBI nr
Match: OMO99206.1 (Transferase, partial [Corchorus capsularis]) HSP 1 Score: 135 bits (340), Expect = 1.56e-38 Identity = 64/86 (74.42%), Postives = 72/86 (83.72%), Query Frame = 0
BLAST of MC02g_new0198 vs. NCBI nr
Match: XP_034892653.1 (benzyl alcohol O-benzoyltransferase-like [Populus alba] >TKR98655.1 hypothetical protein D5086_0000200950 [Populus alba]) HSP 1 Score: 138 bits (347), Expect = 4.37e-38 Identity = 64/86 (74.42%), Postives = 74/86 (86.05%), Query Frame = 0
BLAST of MC02g_new0198 vs. ExPASy TrEMBL
Match: A0A7J9KC38 (Uncharacterized protein (Fragment) OS=Gossypium armourianum OX=34283 GN=Goarm_001157 PE=3 SV=1) HSP 1 Score: 137 bits (345), Expect = 1.31e-39 Identity = 64/86 (74.42%), Postives = 75/86 (87.21%), Query Frame = 0
BLAST of MC02g_new0198 vs. ExPASy TrEMBL
Match: A0A7J9CV16 (Uncharacterized protein OS=Gossypium gossypioides OX=34282 GN=Gogos_001160 PE=3 SV=1) HSP 1 Score: 137 bits (344), Expect = 2.29e-39 Identity = 64/86 (74.42%), Postives = 75/86 (87.21%), Query Frame = 0
BLAST of MC02g_new0198 vs. ExPASy TrEMBL
Match: A0A6J1D5A6 (benzyl alcohol O-benzoyltransferase-like OS=Momordica charantia OX=3673 GN=LOC111017149 PE=3 SV=1) HSP 1 Score: 144 bits (363), Expect = 3.52e-39 Identity = 67/86 (77.91%), Postives = 77/86 (89.53%), Query Frame = 0
BLAST of MC02g_new0198 vs. ExPASy TrEMBL
Match: A0A1R3JWH1 (Transferase (Fragment) OS=Corchorus capsularis OX=210143 GN=CCACVL1_03890 PE=3 SV=1) HSP 1 Score: 135 bits (340), Expect = 7.54e-39 Identity = 64/86 (74.42%), Postives = 72/86 (83.72%), Query Frame = 0
BLAST of MC02g_new0198 vs. ExPASy TrEMBL
Match: A0A4V6A7C9 (Uncharacterized protein OS=Populus alba OX=43335 GN=D5086_0000200950 PE=3 SV=1) HSP 1 Score: 138 bits (347), Expect = 2.12e-38 Identity = 64/86 (74.42%), Postives = 74/86 (86.05%), Query Frame = 0
BLAST of MC02g_new0198 vs. TAIR 10
Match: AT5G17540.1 (HXXXD-type acyl-transferase family protein ) HSP 1 Score: 107.8 bits (268), Expect = 4.3e-24 Identity = 52/82 (63.41%), Postives = 65/82 (79.27%), Query Frame = 0
BLAST of MC02g_new0198 vs. TAIR 10
Match: AT3G03480.1 (acetyl CoA:(Z)-3-hexen-1-ol acetyltransferase ) HSP 1 Score: 107.1 bits (266), Expect = 7.4e-24 Identity = 52/82 (63.41%), Postives = 65/82 (79.27%), Query Frame = 0
BLAST of MC02g_new0198 vs. TAIR 10
Match: AT5G41040.1 (HXXXD-type acyl-transferase family protein ) HSP 1 Score: 72.0 bits (175), Expect = 2.6e-13 Identity = 34/83 (40.96%), Postives = 52/83 (62.65%), Query Frame = 0
BLAST of MC02g_new0198 vs. TAIR 10
Match: AT5G41040.2 (HXXXD-type acyl-transferase family protein ) HSP 1 Score: 72.0 bits (175), Expect = 2.6e-13 Identity = 34/83 (40.96%), Postives = 52/83 (62.65%), Query Frame = 0
BLAST of MC02g_new0198 vs. TAIR 10
Match: AT5G63560.1 (HXXXD-type acyl-transferase family protein ) HSP 1 Score: 65.9 bits (159), Expect = 1.9e-11 Identity = 34/81 (41.98%), Postives = 52/81 (64.20%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|