MC02g_new0139 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTGGGCGTGGGAAGGGAGGCAAGGGCCTGGGAAAGGGAGGAGCCAAGCGTCACAGGAAGGTTTTGAGAGACAACATTCAGGGCATCACGAAGCCTGCAATTCGCCGTCTCGCTCGTAGAGGTGGTGTGAAGCGCATCAGTGGTTTGATCTATGAGGAAACCAGAGGCGTTTTGAAGATTTTCCTCGAGAATGTGATTCGCGATGCTGTTACCTACACGGAGCACGCCAGGAGGAAGACGGTGACCGCCATGGATGTGGTCTATGCGTTGAAGAGGCAGGGAAGAACTCTGTATGGATTCGGAGGTTAG ATGTCTGGGCGTGGGAAGGGAGGCAAGGGCCTGGGAAAGGGAGGAGCCAAGCGTCACAGGAAGGTTTTGAGAGACAACATTCAGGGCATCACGAAGCCTGCAATTCGCCGTCTCGCTCGTAGAGGTGGTGTGAAGCGCATCAGTGGTTTGATCTATGAGGAAACCAGAGGCGTTTTGAAGATTTTCCTCGAGAATGTGATTCGCGATGCTGTTACCTACACGGAGCACGCCAGGAGGAAGACGGTGACCGCCATGGATGTGGTCTATGCGTTGAAGAGGCAGGGAAGAACTCTGTATGGATTCGGAGGTTAG ATGTCTGGGCGTGGGAAGGGAGGCAAGGGCCTGGGAAAGGGAGGAGCCAAGCGTCACAGGAAGGTTTTGAGAGACAACATTCAGGGCATCACGAAGCCTGCAATTCGCCGTCTCGCTCGTAGAGGTGGTGTGAAGCGCATCAGTGGTTTGATCTATGAGGAAACCAGAGGCGTTTTGAAGATTTTCCTCGAGAATGTGATTCGCGATGCTGTTACCTACACGGAGCACGCCAGGAGGAAGACGGTGACCGCCATGGATGTGGTCTATGCGTTGAAGAGGCAGGGAAGAACTCTGTATGGATTCGGAGGTTAG MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG Homology
BLAST of MC02g_new0139 vs. ExPASy Swiss-Prot
Match: P62785 (Histone H4 variant TH011 OS=Triticum aestivum OX=4565 PE=3 SV=2) HSP 1 Score: 199.5 bits (506), Expect = 1.8e-50 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of MC02g_new0139 vs. ExPASy Swiss-Prot
Match: P59259 (Histone H4 OS=Arabidopsis thaliana OX=3702 GN=At1g07660 PE=1 SV=2) HSP 1 Score: 199.5 bits (506), Expect = 1.8e-50 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of MC02g_new0139 vs. ExPASy Swiss-Prot
Match: Q6PMI5 (Histone H4 OS=Chelidonium majus OX=71251 PE=3 SV=3) HSP 1 Score: 199.5 bits (506), Expect = 1.8e-50 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of MC02g_new0139 vs. ExPASy Swiss-Prot
Match: Q6WZ83 (Histone H4 OS=Eucalyptus globulus OX=34317 PE=3 SV=3) HSP 1 Score: 199.5 bits (506), Expect = 1.8e-50 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of MC02g_new0139 vs. ExPASy Swiss-Prot
Match: Q6LAF3 (Histone H4 OS=Flaveria trinervia OX=4227 GN=hh4 PE=3 SV=3) HSP 1 Score: 199.5 bits (506), Expect = 1.8e-50 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of MC02g_new0139 vs. NCBI nr
Match: WP_072354057.1 (MULTISPECIES: hypothetical protein [Gammaproteobacteria] >NP_001131585.1 histone H4 [Zea mays] >NP_001237495.1 histone H4 [Glycine max] >NP_001278493.1 Histone H4 [Zea mays] >NP_001281194.1 Histone H4 [Zea mays] >NP_001313304.1 histone H4 [Zea mays] >NP_001332089.1 Histone superfamily protein [Arabidopsis thaliana] >NP_180441.1 histone H4 [Arabidopsis thaliana] >NP_190179.1 Histone superfamily protein [Arabidopsis thaliana] >NP_190941.1 Histone superfamily protein [Arabidopsis thaliana] >NP_563793.1 Histone superfamily protein [Arabidopsis thaliana] >NP_563797.1 Histone superfamily protein [Arabidopsis thaliana] >NP_568911.1 Histone superfamily protein [Arabidopsis thaliana] >NP_568918.1 Histone superfamily protein [Arabidopsis thaliana] >NP_850660.1 Histone superfamily protein [Arabidopsis thaliana] >NP_850939.1 Histone superfamily protein [Arabidopsis thaliana] >XP_002262845.1 PREDICTED: histone H4 [Vitis vinifera] >XP_002281789.1 PREDICTED: histone H4 [Vitis vinifera] >XP_002284158.1 PREDICTED: histone H4 [Vitis vinifera] >XP_002284564.1 PREDICTED: histone H4 [Vitis vinifera] >XP_002310853.1 histone H4 [Populus trichocarpa] >XP_002310855.1 histone H4 [Populus trichocarpa] >XP_002310859.1 histone H4 [Populus trichocarpa] >XP_002311129.1 histone H4 [Populus trichocarpa] >XP_002324472.1 histone H4 [Populus trichocarpa] >XP_002324474.1 histone H4 [Populus trichocarpa] >XP_002325056.1 histone H4 [Populus trichocarpa] >XP_002439932.1 histone H4 [Sorghum bicolor] >XP_002448395.1 histone H4 [Sorghum bicolor] >XP_002452743.1 histone H4 [Sorghum bicolor] >XP_002455130.1 histone H4 [Sorghum bicolor] >XP_002455131.1 histone H4 [Sorghum bicolor] >XP_002456596.1 histone H4 [Sorghum bicolor] >XP_002457286.1 histone H4 [Sorghum bicolor] >XP_002460250.1 histone H4 [Sorghum bicolor] >XP_002462803.1 histone H4 [Sorghum bicolor] >XP_002465012.1 histone H4 [Sorghum bicolor] >XP_002468624.1 histone H4 [Sorghum bicolor] >XP_002509686.1 histone H4 [Ricinus communis] >XP_002518940.1 histone H4 [Ricinus communis] >XP_002531654.1 histone H4 [Ricinus communis] >XP_002531656.1 histone H4 [Ricinus communis] >XP_002532808.1 histone H4 [Ricinus communis] >XP_002862282.2 histone H4 [Arabidopsis lyrata subsp. lyrata] >XP_002864647.1 histone H4 [Arabidopsis lyrata subsp. lyrata] >XP_002866359.2 histone H4 [Arabidopsis lyrata subsp. lyrata] >XP_003521335.1 histone H4 [Glycine max] >XP_003535987.1 histone H4 [Glycine max] >XP_003538030.1 histone H4 [Glycine max] >XP_003538258.1 histone H4 [Glycine max] >XP_003538259.1 histone H4 [Glycine max] >XP_003538260.1 histone H4 [Glycine max] >XP_003539748.1 histone H4 [Glycine max] >XP_003542580.3 histone H4 [Glycine max] >XP_003544868.1 histone H4 [Glycine max] >XP_003549448.1 histone H4 [Glycine max] >XP_003555742.1 histone H4 [Glycine max] >XP_003557745.1 histone H4 [Brachypodium distachyon] >XP_003557764.1 histone H4 [Brachypodium distachyon] >XP_003558370.1 histone H4 [Brachypodium distachyon] >XP_003558954.1 histone H4 [Brachypodium distachyon] >XP_003578155.1 histone H4 [Brachypodium distachyon] >XP_003578603.1 histone H4 [Brachypodium distachyon] >XP_003597302.1 histone H4 [Medicago truncatula] >XP_003600460.1 histone H4 [Medicago truncatula] >XP_003600922.1 histone H4 [Medicago truncatula] >XP_003606566.1 histone H4 [Medicago truncatula] >XP_003615092.1 histone H4 [Medicago truncatula] >XP_003625481.1 histone H4 [Medicago truncatula] >XP_003627802.1 histone H4 [Medicago truncatula] >XP_004138399.1 histone H4 [Cucumis sativus] >XP_004143095.1 histone H4 [Cucumis sativus] >XP_004143099.1 histone H4 [Cucumis sativus] >XP_004143100.1 histone H4 [Cucumis sativus] >XP_004294590.1 PREDICTED: histone H4 [Fragaria vesca subsp. vesca] >XP_004294591.1 PREDICTED: histone H4 [Fragaria vesca subsp. vesca] >XP_004294592.1 PREDICTED: histone H4 [Fragaria vesca subsp. vesca] >XP_004294628.1 PREDICTED: histone H4 [Fragaria vesca subsp. vesca] >XP_004302787.1 PREDICTED: histone H4 [Fragaria vesca subsp. vesca] >XP_004307447.1 PREDICTED: histone H4 [Fragaria vesca subsp. vesca] >XP_004487047.1 histone H4 [Cicer arietinum] >XP_004500222.1 histone H4 [Cicer arietinum] >XP_004505922.1 histone H4 [Cicer arietinum] >XP_004507853.1 histone H4 [Cicer arietinum] >XP_004511025.1 histone H4 [Cicer arietinum] >XP_004513931.1 histone H4 [Cicer arietinum] >XP_004516180.1 histone H4 [Cicer arietinum] >XP_004953471.1 histone H4 [Setaria italica] >XP_004956919.1 histone H4 [Setaria italica] >XP_004957584.1 histone H4 [Setaria italica] >XP_004961797.1 histone H4 [Setaria italica] >XP_004970497.1 histone H4 [Setaria italica] >XP_004973289.1 histone H4 [Setaria italica] >XP_004976597.1 histone H4 [Setaria italica] >XP_004983800.1 histone H4 [Setaria italica] >XP_004985949.1 histone H4 [Setaria italica] >XP_006279505.1 histone H4 [Capsella rubella] >XP_006292098.1 histone H4 [Capsella rubella] >XP_006292099.1 histone H4 [Capsella rubella] >XP_006295294.1 histone H4 [Capsella rubella] >XP_006303455.1 histone H4 [Capsella rubella] >XP_006303457.1 histone H4 [Capsella rubella] >XP_006349012.1 PREDICTED: histone H4 [Solanum tuberosum] >XP_006381806.1 histone H4 [Populus trichocarpa] >XP_006383119.1 histone H4 [Populus trichocarpa] >XP_006383122.1 histone H4 [Populus trichocarpa] >XP_006400894.1 histone H4 [Eutrema salsugineum] >XP_006400928.1 histone H4 [Eutrema salsugineum] >XP_006403660.1 histone H4 [Eutrema salsugineum] >XP_006409907.1 histone H4 [Eutrema salsugineum] >XP_006410944.1 histone H4 [Eutrema salsugineum] >XP_006417762.1 histone H4 [Eutrema salsugineum] >XP_006418920.1 histone H4 [Eutrema salsugineum] >XP_006418982.1 histone H4 [Eutrema salsugineum] >XP_006424714.1 histone H4 [Citrus clementina] >XP_006424783.1 histone H4 [Citrus clementina] >XP_006429035.1 histone H4 [Citrus clementina] >XP_006453377.1 histone H4 [Citrus clementina] >XP_006474179.1 histone H4 [Citrus sinensis] >XP_006480778.1 histone H4 [Citrus sinensis] >XP_006488229.1 histone H4 [Citrus sinensis] >XP_006488285.1 histone H4 [Citrus sinensis] >XP_006597302.1 histone H4 [Glycine max] >XP_006644971.1 histone H4 [Oryza brachyantha] >XP_006652696.1 histone H4 [Oryza brachyantha] >XP_006660951.2 histone H4 [Oryza brachyantha] >XP_006829196.1 histone H4 [Amborella trichopoda] >XP_006841590.1 histone H4 [Amborella trichopoda] >XP_006845633.1 histone H4 [Amborella trichopoda] >XP_006845635.1 histone H4 [Amborella trichopoda] >XP_006845637.1 histone H4 [Amborella trichopoda] >XP_006856158.1 histone H4 [Amborella trichopoda] >XP_007009385.1 PREDICTED: histone H4 [Theobroma cacao] >XP_007014216.1 PREDICTED: histone H4 [Theobroma cacao] >XP_007016483.1 PREDICTED: histone H4 [Theobroma cacao] >XP_007016577.1 PREDICTED: histone H4 [Theobroma cacao] >XP_007024825.1 PREDICTED: histone H4 [Theobroma cacao] >XP_007027067.1 PREDICTED: histone H4 [Theobroma cacao] >XP_007027069.1 PREDICTED: histone H4 [Theobroma cacao] >XP_007132137.1 hypothetical protein PHAVU_011G069700g [Phaseolus vulgaris] >XP_007142236.1 hypothetical protein PHAVU_008G263800g [Phaseolus vulgaris] >XP_007146746.1 hypothetical protein PHAVU_006G066300g [Phaseolus vulgaris] >XP_007146747.1 hypothetical protein PHAVU_006G066400g [Phaseolus vulgaris] >XP_007146748.1 hypothetical protein PHAVU_006G066400g [Phaseolus vulgaris] >XP_007150264.1 hypothetical protein PHAVU_005G139600g [Phaseolus vulgaris] >XP_007154766.1 hypothetical protein PHAVU_003G145900g [Phaseolus vulgaris] >XP_007162656.1 hypothetical protein PHAVU_001G169200g [Phaseolus vulgaris] >XP_007202793.1 histone H4 [Prunus persica] >XP_007206175.1 histone H4 [Prunus persica] >XP_007206176.1 histone H4 [Prunus persica] >XP_007210543.1 histone H4 [Prunus persica] >XP_007220484.1 histone H4 [Prunus persica] >XP_007220485.1 histone H4 [Prunus persica] >XP_008223213.1 PREDICTED: histone H4 [Prunus mume] >XP_008233523.1 PREDICTED: histone H4 [Prunus mume] >XP_008233524.1 PREDICTED: histone H4 [Prunus mume] >XP_008233596.1 PREDICTED: histone H4 [Prunus mume] >XP_008241245.1 PREDICTED: histone H4 [Prunus mume] >XP_008245808.1 PREDICTED: histone H4 [Prunus mume] >XP_008343545.1 histone H4 [Malus domestica] >XP_008448389.1 PREDICTED: histone H4 [Cucumis melo] >XP_008448390.1 PREDICTED: histone H4 [Cucumis melo] >XP_008448391.1 PREDICTED: histone H4 [Cucumis melo] >XP_008448392.1 PREDICTED: histone H4 [Cucumis melo] >XP_008456764.1 PREDICTED: histone H4 [Cucumis melo] >XP_008456765.1 PREDICTED: histone H4 [Cucumis melo] >XP_008463901.1 PREDICTED: histone H4 [Cucumis melo] >XP_008650256.1 histone H4 [Zea mays] >XP_008656378.1 histone H4 [Zea mays] >XP_008657088.1 histone H4 [Zea mays] >XP_008668985.1 histone H4 [Zea mays] >XP_008668988.2 histone H4 [Zea mays] >XP_008673673.1 histone H4 [Zea mays] >XP_008674854.1 histone H4 [Zea mays] >XP_008781903.1 histone H4 [Phoenix dactylifera] >XP_008804861.1 histone H4 [Phoenix dactylifera] >XP_008812450.1 histone H4 [Phoenix dactylifera] >XP_009103711.2 histone H4 [Brassica rapa] >XP_009110918.2 histone H4 [Brassica rapa] >XP_009116068.1 histone H4 [Brassica rapa] >XP_009118417.1 histone H4 [Brassica rapa] >XP_009126676.2 histone H4 [Brassica rapa] >XP_009131981.1 histone H4 [Brassica rapa] >XP_009133191.2 histone H4 [Brassica rapa] >XP_009133863.1 histone H4 [Brassica rapa] >XP_009140937.1 histone H4 [Brassica rapa] >XP_009141673.1 histone H4 [Brassica rapa] >XP_009143480.1 histone H4 [Brassica rapa] >XP_009148029.2 histone H4 [Brassica rapa] >XP_009150050.2 histone H4 [Brassica rapa] >XP_009337602.1 PREDICTED: histone H4 [Pyrus x bretschneideri] >XP_009380760.1 PREDICTED: histone H4 [Musa acuminata subsp. malaccensis] >XP_009382750.1 PREDICTED: histone H4 [Musa acuminata subsp. malaccensis] >XP_009384902.1 PREDICTED: histone H4 [Musa acuminata subsp. malaccensis] >XP_009390508.1 PREDICTED: histone H4 [Musa acuminata subsp. malaccensis] >XP_009394094.1 PREDICTED: histone H4 [Musa acuminata subsp. malaccensis] >XP_009394189.1 PREDICTED: histone H4 [Musa acuminata subsp. malaccensis] >XP_009394577.1 PREDICTED: histone H4 [Musa acuminata subsp. malaccensis] >XP_009401269.1 PREDICTED: histone H4 [Musa acuminata subsp. malaccensis] >XP_009406967.1 PREDICTED: histone H4 [Musa acuminata subsp. malaccensis] >XP_009409540.1 PREDICTED: histone H4 [Musa acuminata subsp. malaccensis] >XP_009414300.1 PREDICTED: histone H4 [Musa acuminata subsp. malaccensis] >XP_009416257.1 PREDICTED: histone H4 [Musa acuminata subsp. malaccensis] >XP_009420019.1 PREDICTED: histone H4 [Musa acuminata subsp. malaccensis] >XP_009420833.1 PREDICTED: histone H4 [Musa acuminata subsp. malaccensis] >XP_009591402.1 histone H4 [Nicotiana tomentosiformis] >XP_009600261.1 histone H4 [Nicotiana tomentosiformis] >XP_009607922.1 histone H4 [Nicotiana tomentosiformis] >XP_009609514.1 histone H4 [Nicotiana tomentosiformis] >XP_009757026.1 PREDICTED: histone H4 [Nicotiana sylvestris] >XP_009767266.1 PREDICTED: histone H4 [Nicotiana sylvestris] >XP_009777185.1 PREDICTED: histone H4 [Nicotiana sylvestris] >XP_009791880.1 PREDICTED: histone H4 [Nicotiana sylvestris] >XP_009794491.1 PREDICTED: histone H4 [Nicotiana sylvestris] >XP_009798388.1 PREDICTED: histone H4 [Nicotiana sylvestris] >XP_010030574.1 histone H4 [Eucalyptus grandis] >XP_010032258.2 histone H4 [Eucalyptus grandis] >XP_010033143.1 histone H4 [Eucalyptus grandis] >XP_010037716.1 histone H4 [Eucalyptus grandis] >XP_010037848.1 histone H4 [Eucalyptus grandis] >XP_010053044.1 histone H4 [Eucalyptus grandis] >XP_010056038.1 histone H4 [Eucalyptus grandis] >XP_010092782.1 histone H4 [Morus notabilis] >XP_010093009.1 histone H4 [Morus notabilis] >XP_010104910.1 histone H4 [Morus notabilis] >XP_010231275.1 histone H4 [Brachypodium distachyon] >XP_010246201.1 PREDICTED: histone H4 [Nelumbo nucifera] >XP_010246202.1 PREDICTED: histone H4 [Nelumbo nucifera] >XP_010246203.1 PREDICTED: histone H4 [Nelumbo nucifera] >XP_010262272.1 PREDICTED: histone H4 [Nelumbo nucifera] >XP_010262273.1 PREDICTED: histone H4 [Nelumbo nucifera] >XP_010262275.1 PREDICTED: histone H4 [Nelumbo nucifera] >XP_010262276.1 PREDICTED: histone H4 [Nelumbo nucifera] >XP_010263120.1 PREDICTED: histone H4 [Nelumbo nucifera] >XP_010264531.1 PREDICTED: histone H4 [Nelumbo nucifera] >XP_010264574.1 PREDICTED: histone H4 [Nelumbo nucifera] >XP_010313299.1 histone H4 [Solanum lycopersicum] >XP_010426021.1 PREDICTED: histone H4 [Camelina sativa] >XP_010426070.1 PREDICTED: histone H4 [Camelina sativa] >XP_010427032.1 PREDICTED: histone H4 [Camelina sativa] >XP_010443740.1 PREDICTED: histone H4 [Camelina sativa] >XP_010443785.1 PREDICTED: histone H4 [Camelina sativa] >XP_010455395.1 PREDICTED: histone H4 [Camelina sativa] >XP_010455780.1 PREDICTED: histone H4 [Camelina sativa] >XP_010457960.1 PREDICTED: histone H4 [Camelina sativa] >XP_010457961.1 PREDICTED: histone H4 [Camelina sativa] >XP_010457987.1 PREDICTED: histone H4 isoform X2 [Camelina sativa] >XP_010457988.1 PREDICTED: histone H4 isoform X1 [Camelina sativa] >XP_010475534.1 PREDICTED: histone H4 [Camelina sativa] >XP_010475535.1 PREDICTED: histone H4 [Camelina sativa] >XP_010475557.1 PREDICTED: histone H4 [Camelina sativa] >XP_010483612.1 PREDICTED: histone H4 [Camelina sativa] >XP_010487799.1 PREDICTED: histone H4 [Camelina sativa] >XP_010488030.1 PREDICTED: histone H4 [Camelina sativa] >XP_010503204.1 PREDICTED: histone H4 [Camelina sativa] >XP_010503249.1 PREDICTED: histone H4 [Camelina sativa] >XP_010504143.1 PREDICTED: histone H4 [Camelina sativa] >XP_010510587.1 PREDICTED: histone H4 [Camelina sativa] >XP_010514915.1 PREDICTED: histone H4 [Camelina sativa] >XP_010514961.1 PREDICTED: histone H4 [Camelina sativa] >XP_010515874.1 PREDICTED: histone H4 [Camelina sativa] >XP_010520287.1 PREDICTED: histone H4 [Tarenaya hassleriana] >XP_010520288.1 PREDICTED: histone H4 [Tarenaya hassleriana] >XP_010521821.1 PREDICTED: histone H4 [Tarenaya hassleriana] >XP_010521900.1 PREDICTED: histone H4 [Tarenaya hassleriana] >XP_010541393.1 PREDICTED: histone H4 [Tarenaya hassleriana] >XP_010542611.1 PREDICTED: histone H4 [Tarenaya hassleriana] >XP_010542654.1 PREDICTED: histone H4 [Tarenaya hassleriana] >XP_010557281.1 PREDICTED: histone H4 [Tarenaya hassleriana] >XP_010557296.1 PREDICTED: histone H4 [Tarenaya hassleriana] >XP_010672778.1 PREDICTED: histone H4 [Beta vulgaris subsp. vulgaris] >XP_010680743.1 PREDICTED: histone H4 [Beta vulgaris subsp. vulgaris] >XP_010685810.1 PREDICTED: histone H4 [Beta vulgaris subsp. vulgaris] >XP_010693814.1 PREDICTED: histone H4 [Beta vulgaris subsp. vulgaris] >XP_010695592.1 PREDICTED: histone H4 [Beta vulgaris subsp. vulgaris] >XP_010695599.1 PREDICTED: histone H4 [Beta vulgaris subsp. vulgaris] >XP_010907491.1 histone H4 [Elaeis guineensis] >XP_010913659.1 histone H4 [Elaeis guineensis] >XP_010914145.1 histone H4 [Elaeis guineensis] >XP_010920757.1 histone H4 [Elaeis guineensis] >XP_010928661.1 histone H4 [Elaeis guineensis] >XP_010935331.1 histone H4 [Elaeis guineensis] >XP_010937748.1 histone H4 [Elaeis guineensis] >XP_010940230.1 histone H4 [Elaeis guineensis] >XP_011009519.1 PREDICTED: histone H4 [Populus euphratica] >XP_011013668.1 PREDICTED: histone H4 [Populus euphratica] >XP_011013671.1 PREDICTED: histone H4 [Populus euphratica] >XP_011018258.1 PREDICTED: histone H4 [Populus euphratica] >XP_011018338.1 PREDICTED: histone H4 [Populus euphratica] >XP_011025936.1 PREDICTED: histone H4 [Populus euphratica] >XP_011025939.1 PREDICTED: histone H4 [Populus euphratica] >XP_011025955.1 PREDICTED: histone H4 [Populus euphratica] >XP_011027073.1 PREDICTED: histone H4 [Populus euphratica] >XP_011043210.1 PREDICTED: histone H4 [Populus euphratica] >XP_011043213.1 PREDICTED: histone H4 [Populus euphratica] >XP_011043969.1 PREDICTED: histone H4 [Populus euphratica] >XP_011043970.1 PREDICTED: histone H4 isoform X1 [Populus euphratica] >XP_011043971.1 PREDICTED: histone H4 isoform X2 [Populus euphratica] >XP_011043972.1 PREDICTED: histone H4 isoform X3 [Populus euphratica] >XP_011076639.1 histone H4 [Sesamum indicum] >XP_011077456.1 histone H4 [Sesamum indicum] >XP_011077544.1 histone H4 [Sesamum indicum] >XP_011084861.1 histone H4 [Sesamum indicum] >XP_011089394.1 histone H4 [Sesamum indicum] >XP_011094841.1 histone H4 [Sesamum indicum] >XP_011095029.1 histone H4 [Sesamum indicum] >XP_011095589.1 histone H4 [Sesamum indicum] >XP_011097720.1 histone H4 [Sesamum indicum] >XP_011101872.1 histone H4 [Sesamum indicum] >XP_011469720.1 PREDICTED: histone H4 [Fragaria vesca subsp. vesca] >XP_011469723.1 PREDICTED: histone H4 [Fragaria vesca subsp. vesca] >XP_011622317.1 histone H4 [Amborella trichopoda] >XP_011623050.1 histone H4 [Amborella trichopoda] >XP_011623051.1 histone H4 [Amborella trichopoda] >XP_011653471.1 histone H4 [Cucumis sativus] >XP_012074058.1 histone H4 [Jatropha curcas] >XP_012087045.1 histone H4 [Jatropha curcas] >XP_012441522.1 PREDICTED: histone H4 [Gossypium raimondii] >XP_012442871.1 PREDICTED: histone H4 [Gossypium raimondii] >XP_012456440.1 PREDICTED: histone H4 [Gossypium raimondii] >XP_012460773.1 PREDICTED: histone H4 [Gossypium raimondii] >XP_012461907.1 PREDICTED: histone H4 [Gossypium raimondii] >XP_012465147.1 PREDICTED: histone H4 [Gossypium raimondii] >XP_012468389.1 PREDICTED: histone H4 [Gossypium raimondii] >XP_012469798.1 PREDICTED: histone H4 [Gossypium raimondii] >XP_012471384.1 PREDICTED: histone H4 [Gossypium raimondii] >XP_012471433.1 PREDICTED: histone H4 [Gossypium raimondii] >XP_012472789.1 PREDICTED: histone H4 [Gossypium raimondii] >XP_012472799.1 PREDICTED: histone H4 [Gossypium raimondii] >XP_012827931.1 PREDICTED: histone H4 [Erythranthe guttata] >XP_012831997.1 PREDICTED: histone H4 [Erythranthe guttata] >XP_012832191.1 PREDICTED: histone H4 [Erythranthe guttata] >XP_012841834.1 PREDICTED: histone H4 [Erythranthe guttata] >XP_012848703.1 PREDICTED: histone H4 [Erythranthe guttata] >XP_012850355.1 PREDICTED: histone H4 [Erythranthe guttata] >XP_012850464.1 PREDICTED: histone H4 [Erythranthe guttata] >XP_012850911.1 PREDICTED: histone H4 [Erythranthe guttata] >XP_012858790.1 PREDICTED: histone H4 [Erythranthe guttata] >XP_013448040.1 histone H4 [Medicago truncatula] >XP_013459905.1 histone H4 [Medicago truncatula] >XP_013460134.1 histone H4 [Medicago truncatula] >XP_013460151.1 histone H4 [Medicago truncatula] >XP_013583915.1 PREDICTED: histone H4 [Brassica oleracea var. oleracea] >XP_013588638.1 PREDICTED: histone H4 [Brassica oleracea var. oleracea] >XP_013600442.1 PREDICTED: histone H4 [Brassica oleracea var. oleracea] >XP_013602591.1 PREDICTED: histone H4 [Brassica oleracea var. oleracea] >XP_013605168.1 PREDICTED: histone H4 [Brassica oleracea var. oleracea] >XP_013615993.1 PREDICTED: histone H4 [Brassica oleracea var. oleracea] >XP_013622579.1 PREDICTED: histone H4 [Brassica oleracea var. oleracea] >XP_013623511.1 PREDICTED: histone H4 [Brassica oleracea var. oleracea] >XP_013625358.1 PREDICTED: histone H4 [Brassica oleracea var. oleracea] >XP_013630704.1 PREDICTED: histone H4 [Brassica oleracea var. oleracea] >XP_013631522.1 PREDICTED: histone H4 [Brassica oleracea var. oleracea] >XP_013632073.1 PREDICTED: histone H4 [Brassica oleracea var. oleracea] >XP_013633957.1 PREDICTED: histone H4 [Brassica oleracea var. oleracea] >XP_013637962.1 PREDICTED: histone H4 [Brassica oleracea var. oleracea] >XP_013641146.1 histone H4 [Brassica napus] >XP_013641159.1 histone H4 [Brassica napus] >XP_013642542.1 histone H4 [Brassica napus] >XP_013647689.1 histone H4 [Brassica napus] >XP_013657574.1 histone H4 [Brassica napus] >XP_013661167.1 histone H4 [Brassica napus] >XP_013676426.1 histone H4 [Brassica napus] >XP_013678307.1 histone H4 [Brassica napus] >XP_013680780.1 histone H4 isoform X1 [Brassica napus] >XP_013680787.1 histone H4 isoform X2 [Brassica napus] >XP_013681707.1 histone H4 [Brassica napus] >XP_013689098.1 histone H4 [Brassica napus] >XP_013691794.1 histone H4 [Brassica napus] >XP_013695902.1 histone H4 [Brassica napus] >XP_013699203.1 histone H4 [Brassica napus] >XP_013702039.1 histone H4 [Brassica napus] >XP_013708064.1 histone H4 [Brassica napus] >XP_013708232.1 histone H4 [Brassica napus] >XP_013716269.1 histone H4 [Brassica napus] >XP_013723951.1 histone H4 [Brassica napus] >XP_013729484.1 histone H4 [Brassica napus] >XP_013732634.1 histone H4 [Brassica napus] >XP_013733729.1 histone H4 [Brassica napus] >XP_013734919.1 histone H4 [Brassica napus] >XP_013738370.1 histone H4 [Brassica napus] >XP_013744194.1 histone H4 [Brassica napus] >XP_013744725.1 histone H4 [Brassica napus] >XP_013748348.1 histone H4 [Brassica napus] >XP_014493889.1 histone H4 [Vigna radiata var. radiata] >XP_014494409.1 histone H4 [Vigna radiata var. radiata] >XP_014494432.1 histone H4 [Vigna radiata var. radiata] >XP_014496235.1 histone H4 [Vigna radiata var. radiata] >XP_014498124.1 histone H4 [Vigna radiata var. radiata] >XP_014505099.1 histone H4 [Vigna radiata var. radiata] >XP_014518271.1 histone H4 [Vigna radiata var. radiata] >XP_014624656.1 histone H4 [Glycine max] >XP_014755701.1 histone H4 [Brachypodium distachyon] >XP_014758281.1 histone H4 [Brachypodium distachyon] >XP_015057055.1 histone H4 [Solanum pennellii] >XP_015578392.1 histone H4 [Ricinus communis] >XP_015610672.1 histone H4 [Oryza sativa Japonica Group] >XP_015612705.1 histone H4 [Oryza sativa Japonica Group] >XP_015612982.1 histone H4 [Oryza sativa Japonica Group] >XP_015614455.1 histone H4 [Oryza sativa Japonica Group] >XP_015627403.1 histone H4 [Oryza sativa Japonica Group] >XP_015628561.1 histone H4 [Oryza sativa Japonica Group] >XP_015636819.1 histone H4 [Oryza sativa Japonica Group] >XP_015637997.1 histone H4 [Oryza sativa Japonica Group] >XP_015639309.1 histone H4 [Oryza sativa Japonica Group] >XP_015645242.1 histone H4 [Oryza sativa Japonica Group] >XP_015692626.2 histone H4 [Oryza brachyantha] >XP_015696541.2 histone H4 [Oryza brachyantha] >XP_015874145.1 histone H4 [Ziziphus jujuba] >XP_015876988.1 histone H4 [Ziziphus jujuba] >XP_015877066.1 histone H4 [Ziziphus jujuba] >XP_015900237.1 histone H4 [Ziziphus jujuba] >XP_015901777.1 histone H4 [Ziziphus jujuba] >XP_015932139.1 histone H4 [Arachis duranensis] >XP_015933867.1 histone H4 [Arachis duranensis] >XP_015949070.1 histone H4 [Arachis duranensis] >XP_015949071.1 histone H4 [Arachis duranensis] >XP_015949133.1 histone H4 [Arachis duranensis] >XP_015956746.1 histone H4 [Arachis duranensis] >XP_015958826.1 histone H4 [Arachis duranensis] >XP_016166903.1 histone H4 [Arachis ipaensis] >XP_016183210.1 histone H4 [Arachis ipaensis] >XP_016183212.1 histone H4 [Arachis ipaensis] >XP_016183239.1 histone H4 [Arachis ipaensis] >XP_016190129.1 histone H4 [Arachis ipaensis] >XP_016197256.1 histone H4 [Arachis ipaensis] >XP_016201174.1 histone H4 [Arachis ipaensis] >XP_016201187.1 histone H4 [Arachis ipaensis] >XP_016201198.1 histone H4 [Arachis ipaensis] >XP_016452786.1 PREDICTED: histone H4 [Nicotiana tabacum] >XP_016455516.1 PREDICTED: histone H4 [Nicotiana tabacum] >XP_016459669.1 PREDICTED: histone H4 [Nicotiana tabacum] >XP_016475587.1 PREDICTED: histone H4 [Nicotiana tabacum] >XP_016476748.1 PREDICTED: histone H4 [Nicotiana tabacum] >XP_016477054.1 PREDICTED: histone H4 [Nicotiana tabacum] >XP_016483711.1 PREDICTED: histone H4 [Nicotiana tabacum] >XP_016491075.1 PREDICTED: histone H4 [Nicotiana tabacum] >XP_016497947.1 PREDICTED: histone H4 [Nicotiana tabacum] >XP_016501198.1 PREDICTED: histone H4 [Nicotiana tabacum] >XP_016501825.1 PREDICTED: histone H4 [Nicotiana tabacum] >XP_016575872.1 PREDICTED: histone H4 [Capsicum annuum] >XP_016665187.1 histone H4 [Gossypium hirsutum] >XP_016665209.1 histone H4 [Gossypium hirsutum] >XP_016688571.2 histone H4 [Gossypium hirsutum] >XP_016697953.1 histone H4 [Gossypium hirsutum] >XP_016718727.1 histone H4 [Gossypium hirsutum] >XP_016719940.1 histone H4 [Gossypium hirsutum] >XP_016719942.2 histone H4 [Gossypium hirsutum] >XP_016719943.1 histone H4 [Gossypium hirsutum] >XP_016720273.1 histone H4 [Gossypium hirsutum] >XP_016727035.1 histone H4 [Gossypium hirsutum] >XP_016739036.1 histone H4 [Gossypium hirsutum] >XP_016740566.1 histone H4 [Gossypium hirsutum] >XP_016740603.1 histone H4 [Gossypium hirsutum] >XP_016747150.2 histone H4 [Gossypium hirsutum] >XP_016749120.1 histone H4 [Gossypium hirsutum] >XP_016750530.1 histone H4 [Gossypium hirsutum] >XP_017221901.1 PREDICTED: histone H4 [Daucus carota subsp. sativus] >XP_017221902.1 PREDICTED: histone H4 [Daucus carota subsp. sativus] >XP_017232728.1 PREDICTED: histone H4 [Daucus carota subsp. sativus] >XP_017235819.1 PREDICTED: histone H4 [Daucus carota subsp. sativus] >XP_017235820.1 PREDICTED: histone H4 [Daucus carota subsp. sativus] >XP_017235821.1 PREDICTED: histone H4 [Daucus carota subsp. sativus] >XP_017244001.1 PREDICTED: histone H4 [Daucus carota subsp. sativus] >XP_017244283.1 PREDICTED: histone H4 [Daucus carota subsp. sativus] >XP_017244627.1 PREDICTED: histone H4 [Daucus carota subsp. sativus] >XP_017244681.1 PREDICTED: histone H4 [Daucus carota subsp. sativus] >XP_017248895.1 PREDICTED: histone H4 [Daucus carota subsp. sativus] >XP_017250137.1 PREDICTED: histone H4 [Daucus carota subsp. sativus] >XP_017251355.1 PREDICTED: histone H4 [Daucus carota subsp. sativus] >XP_017406841.1 PREDICTED: histone H4 [Vigna angularis] >XP_017409675.1 PREDICTED: histone H4 [Vigna angularis] >XP_017410781.1 PREDICTED: histone H4 [Vigna angularis] >XP_017425797.1 PREDICTED: histone H4 [Vigna angularis] >XP_017425798.1 PREDICTED: histone H4 [Vigna angularis] >XP_017431445.1 PREDICTED: histone H4 [Vigna angularis] >XP_017432606.1 PREDICTED: histone H4 [Vigna angularis] >XP_017432919.1 PREDICTED: histone H4 [Vigna angularis] >XP_017436612.1 PREDICTED: histone H4 [Vigna angularis] >XP_017436614.1 PREDICTED: histone H4 [Vigna angularis] >XP_017606882.1 PREDICTED: histone H4 [Gossypium arboreum] >XP_017612737.1 PREDICTED: histone H4 [Gossypium arboreum] >XP_017617154.1 PREDICTED: histone H4 [Gossypium arboreum] >XP_017619313.1 PREDICTED: histone H4 [Gossypium arboreum] >XP_017619881.1 PREDICTED: histone H4 [Gossypium arboreum] >XP_017623963.1 PREDICTED: histone H4 [Gossypium arboreum] >XP_017638499.1 PREDICTED: histone H4 [Gossypium arboreum] >XP_017639016.1 PREDICTED: histone H4 [Gossypium arboreum] >XP_017639068.1 PREDICTED: histone H4 [Gossypium arboreum] >XP_017643271.1 PREDICTED: histone H4 [Gossypium arboreum] >XP_017644832.1 PREDICTED: histone H4 [Gossypium arboreum] >XP_017647212.1 PREDICTED: histone H4 [Gossypium arboreum] >XP_017985006.1 PREDICTED: histone H4 [Theobroma cacao] >XP_018434873.1 PREDICTED: histone H4 [Raphanus sativus] >XP_018436511.1 PREDICTED: histone H4 [Raphanus sativus] >XP_018439064.1 PREDICTED: histone H4 [Raphanus sativus] >XP_018450669.1 PREDICTED: histone H4 [Raphanus sativus] >XP_018450799.1 PREDICTED: histone H4 [Raphanus sativus] >XP_018450800.1 PREDICTED: histone H4 [Raphanus sativus] >XP_018463191.1 PREDICTED: histone H4 [Raphanus sativus] >XP_018465955.1 PREDICTED: histone H4 [Raphanus sativus] >XP_018465956.1 PREDICTED: histone H4 [Raphanus sativus] >XP_018466002.1 PREDICTED: histone H4 [Raphanus sativus] >XP_018473023.1 PREDICTED: histone H4 [Raphanus sativus] >XP_018474564.1 PREDICTED: histone H4 [Raphanus sativus] >XP_018478486.1 PREDICTED: histone H4 [Raphanus sativus] >XP_018486629.1 PREDICTED: histone H4 [Raphanus sativus] >XP_018489416.1 PREDICTED: histone H4 [Raphanus sativus] >XP_018490753.1 PREDICTED: histone H4 [Raphanus sativus] >XP_018623612.1 histone H4 [Nicotiana tomentosiformis] >XP_018728943.2 histone H4 [Eucalyptus grandis] >XP_018823320.1 histone H4 [Juglans regia] >XP_018824592.1 histone H4 [Juglans regia] >XP_018831351.1 histone H4 [Juglans regia] >XP_018836019.1 histone H4 [Juglans regia] >XP_018842042.1 histone H4 [Juglans regia] >XP_019080189.1 PREDICTED: histone H4 [Vitis vinifera] >XP_019091613.1 PREDICTED: histone H4 isoform X3 [Camelina sativa] >XP_019108317.1 PREDICTED: histone H4 [Beta vulgaris subsp. vulgaris] >XP_019164344.1 PREDICTED: histone H4 [Ipomoea nil] >XP_019164404.1 PREDICTED: histone H4 [Ipomoea nil] >XP_019164405.1 PREDICTED: histone H4 [Ipomoea nil] >XP_019164409.1 PREDICTED: histone H4 [Ipomoea nil] >XP_019164410.1 PREDICTED: histone H4 [Ipomoea nil] >XP_019177310.1 PREDICTED: histone H4 [Ipomoea nil] >XP_019178794.1 PREDICTED: histone H4 [Ipomoea nil] >XP_019192695.1 PREDICTED: histone H4 [Ipomoea nil] >XP_019199555.1 PREDICTED: histone H4 [Ipomoea nil] >XP_019199556.1 PREDICTED: histone H4 [Ipomoea nil] >XP_019199558.1 PREDICTED: histone H4 [Ipomoea nil] >XP_019199568.1 PREDICTED: histone H4 [Ipomoea nil] >XP_019224160.1 PREDICTED: histone H4 [Nicotiana attenuata] >XP_019224162.1 PREDICTED: histone H4 [Nicotiana attenuata] >XP_019228913.1 PREDICTED: histone H4 [Nicotiana attenuata] >XP_019230718.1 PREDICTED: histone H4 [Nicotiana attenuata] >XP_019231939.1 PREDICTED: histone H4 [Nicotiana attenuata] >XP_019237410.1 PREDICTED: histone H4 [Nicotiana attenuata] >XP_019256679.1 PREDICTED: histone H4 [Nicotiana attenuata] >XP_019256680.1 PREDICTED: histone H4 [Nicotiana attenuata] >XP_019258070.1 PREDICTED: histone H4 [Nicotiana attenuata] >XP_019263034.1 PREDICTED: histone H4 [Nicotiana attenuata] >XP_019266516.1 PREDICTED: histone H4 [Nicotiana attenuata] >XP_019416384.1 PREDICTED: histone H4 [Lupinus angustifolius] >XP_019417437.1 PREDICTED: histone H4 [Lupinus angustifolius] >XP_019426269.1 PREDICTED: histone H4 [Lupinus angustifolius] >XP_019426607.1 PREDICTED: histone H4 [Lupinus angustifolius] >XP_019440955.1 PREDICTED: histone H4 [Lupinus angustifolius] >XP_019440956.1 PREDICTED: histone H4 [Lupinus angustifolius] >XP_019440957.1 PREDICTED: histone H4 [Lupinus angustifolius] >XP_019444402.1 PREDICTED: histone H4 [Lupinus angustifolius] >XP_019448676.1 PREDICTED: histone H4 [Lupinus angustifolius] >XP_019448677.1 PREDICTED: histone H4 [Lupinus angustifolius] >XP_019453594.1 PREDICTED: histone H4 [Lupinus angustifolius] >XP_019454345.1 PREDICTED: histone H4 [Lupinus angustifolius] >XP_019455688.1 PREDICTED: histone H4 [Lupinus angustifolius] >XP_019457387.1 PREDICTED: histone H4 [Lupinus angustifolius] >XP_019457388.1 PREDICTED: histone H4 [Lupinus angustifolius] >XP_019459107.1 PREDICTED: histone H4 [Lupinus angustifolius] >XP_019460698.1 PREDICTED: histone H4 [Lupinus angustifolius] >XP_019464757.1 PREDICTED: histone H4 [Lupinus angustifolius] >XP_019702445.1 histone H4 [Elaeis guineensis] >XP_020080562.1 histone H4 [Ananas comosus] >XP_020083540.1 histone H4 [Ananas comosus] >XP_020084450.1 histone H4 [Ananas comosus] >XP_020085925.1 histone H4 [Ananas comosus] >XP_020091513.1 histone H4 [Ananas comosus] >XP_020093856.1 histone H4 [Ananas comosus] >XP_020103264.1 histone H4 [Ananas comosus] >XP_020113492.1 histone H4 [Ananas comosus] >XP_020114137.1 histone H4 [Ananas comosus] >XP_020146241.1 histone H4 [Aegilops tauschii subsp. strangulata] >XP_020146435.1 LOW QUALITY PROTEIN: histone H4 [Aegilops tauschii subsp. strangulata] >XP_020153967.1 histone H4 [Aegilops tauschii subsp. strangulata] >XP_020160641.1 histone H4 [Aegilops tauschii subsp. strangulata] >XP_020161978.1 histone H4 [Aegilops tauschii subsp. strangulata] >XP_020164571.1 histone H4 [Aegilops tauschii subsp. strangulata] >XP_020164951.1 histone H4 [Aegilops tauschii subsp. strangulata] >XP_020165875.1 histone H4 [Aegilops tauschii subsp. strangulata] >XP_020165901.1 histone H4 [Aegilops tauschii subsp. strangulata] >XP_020172790.1 histone H4 [Aegilops tauschii subsp. strangulata] >XP_020176330.1 histone H4 [Aegilops tauschii subsp. strangulata] >XP_020176567.1 histone H4 [Aegilops tauschii subsp. strangulata] >XP_020176763.2 histone H4 [Aegilops tauschii subsp. strangulata] >XP_020180110.1 histone H4 [Aegilops tauschii subsp. strangulata] >XP_020183599.1 histone H4 [Aegilops tauschii subsp. strangulata] >XP_020183604.1 histone H4 [Aegilops tauschii subsp. strangulata] >XP_020183951.1 histone H4 [Aegilops tauschii subsp. strangulata] >XP_020186569.1 histone H4 [Aegilops tauschii subsp. strangulata] >XP_020189180.1 histone H4 [Aegilops tauschii subsp. strangulata] >XP_020189184.1 histone H4 [Aegilops tauschii subsp. strangulata] >XP_020189186.1 histone H4 [Aegilops tauschii subsp. strangulata] >XP_020190975.1 histone H4 [Aegilops tauschii subsp. strangulata] >XP_020195819.1 histone H4 [Aegilops tauschii subsp. strangulata] >XP_020195820.1 histone H4 [Aegilops tauschii subsp. strangulata] >XP_020195821.1 histone H4 [Aegilops tauschii subsp. strangulata] >XP_020199877.1 histone H4 [Aegilops tauschii subsp. strangulata] >XP_020201075.1 histone H4 [Aegilops tauschii subsp. strangulata] >XP_020207752.1 histone H4 [Cajanus cajan] >XP_020214786.1 histone H4 [Cajanus cajan] >XP_020221135.1 histone H4 [Cajanus cajan] >XP_020223991.1 histone H4 [Cajanus cajan] >XP_020227233.1 histone H4 [Cajanus cajan] >XP_020236808.1 histone H4 [Cajanus cajan] >XP_020239049.1 histone H4 [Cajanus cajan] >XP_020241898.1 histone H4 [Asparagus officinalis] >XP_020244089.1 histone H4 [Asparagus officinalis] >XP_020264716.1 histone H4 [Asparagus officinalis] >XP_020270212.1 histone H4 [Asparagus officinalis] >XP_020275824.1 histone H4 [Asparagus officinalis] >XP_020551922.1 histone H4 [Sesamum indicum] >XP_020574636.1 histone H4 [Phalaenopsis equestris] >XP_020575609.1 histone H4 [Phalaenopsis equestris] >XP_020582078.1 histone H4 [Phalaenopsis equestris] >XP_020587032.1 histone H4 [Phalaenopsis equestris] >XP_020597240.1 histone H4 [Phalaenopsis equestris] >XP_020674550.1 histone H4 [Dendrobium catenatum] >XP_020674934.1 histone H4 [Dendrobium catenatum] >XP_020685660.1 histone H4 [Dendrobium catenatum] >XP_020685681.1 histone H4 [Dendrobium catenatum] >XP_020692374.1 histone H4 [Dendrobium catenatum] >XP_020692375.1 histone H4 [Dendrobium catenatum] >XP_020693310.1 histone H4 [Dendrobium catenatum] >XP_020868710.1 histone H4 [Arabidopsis lyrata subsp. lyrata] >XP_020868758.1 histone H4 [Arabidopsis lyrata subsp. lyrata] >XP_020879701.1 histone H4 [Arabidopsis lyrata subsp. lyrata] >XP_020880172.1 histone H4 [Arabidopsis lyrata subsp. lyrata] >XP_020880298.1 histone H4 [Arabidopsis lyrata subsp. lyrata] >XP_020884530.1 histone H4 [Arabidopsis lyrata subsp. lyrata] >XP_020999550.1 histone H4 [Arachis duranensis] >XP_020999556.1 histone H4 [Arachis duranensis] >XP_021276513.1 histone H4 [Herrania umbratica] >XP_021278635.1 histone H4 [Herrania umbratica] >XP_021279187.1 histone H4 [Herrania umbratica] >XP_021288954.1 histone H4 [Herrania umbratica] >XP_021288955.1 histone H4 [Herrania umbratica] >XP_021295066.1 histone H4 [Herrania umbratica] >XP_021295273.1 histone H4 [Herrania umbratica] >XP_021295923.1 histone H4 [Herrania umbratica] >XP_021591740.1 histone H4 [Manihot esculenta] >XP_021604719.1 histone H4 [Manihot esculenta] >XP_021609403.1 histone H4 [Manihot esculenta] >XP_021609540.1 histone H4 [Manihot esculenta] >XP_021615854.1 histone H4 [Manihot esculenta] >XP_021617492.1 histone H4 [Manihot esculenta] >XP_021624939.1 histone H4 [Manihot esculenta] >XP_021628581.1 histone H4 [Manihot esculenta] >XP_021630441.1 histone H4 [Manihot esculenta] >XP_021638501.1 histone H4 [Hevea brasiliensis] >XP_021640757.1 histone H4 [Hevea brasiliensis] >XP_021654410.1 histone H4 [Hevea brasiliensis] >XP_021658344.1 histone H4 [Hevea brasiliensis] >XP_021663081.1 histone H4 [Hevea brasiliensis] >XP_021665395.1 histone H4 [Hevea brasiliensis] >XP_021666604.1 histone H4 [Hevea brasiliensis] >XP_021674886.1 histone H4 [Hevea brasiliensis] >XP_021681117.1 histone H4 [Hevea brasiliensis] >XP_021687392.1 histone H4 [Hevea brasiliensis] >XP_021687393.1 histone H4 [Hevea brasiliensis] >XP_021689202.1 histone H4 [Hevea brasiliensis] >XP_021713480.1 histone H4 [Chenopodium quinoa] >XP_021716192.1 histone H4 [Chenopodium quinoa] >XP_021720904.1 histone H4 [Chenopodium quinoa] >XP_021721601.1 histone H4 [Chenopodium quinoa] >XP_021738317.1 histone H4 [Chenopodium quinoa] >XP_021741144.1 histone H4 [Chenopodium quinoa] >XP_021757711.1 histone H4 [Chenopodium quinoa] >XP_021757712.1 histone H4 [Chenopodium quinoa] >XP_021766201.1 histone H4 [Chenopodium quinoa] >XP_021766202.1 histone H4 [Chenopodium quinoa] >XP_021767869.1 histone H4 [Chenopodium quinoa] >XP_021767870.1 histone H4 [Chenopodium quinoa] >XP_021769562.1 histone H4 [Chenopodium quinoa] >XP_021770972.1 histone H4 [Chenopodium quinoa] >XP_021770973.1 histone H4 [Chenopodium quinoa] >XP_021771231.1 histone H4 [Chenopodium quinoa] >XP_021811294.1 histone H4 [Prunus avium] >XP_021813846.1 histone H4 [Prunus avium] >XP_021813868.1 histone H4 [Prunus avium] >XP_021816542.1 histone H4 [Prunus avium] >XP_021819100.1 histone H4 [Prunus avium] >XP_021820341.1 histone H4 [Prunus avium] >XP_021824009.1 histone H4 [Prunus avium] >XP_021845438.1 histone H4 [Spinacia oleracea] >XP_021848374.1 histone H4 [Spinacia oleracea] >XP_021849088.1 histone H4 [Spinacia oleracea] >XP_021850397.1 histone H4 [Spinacia oleracea] >XP_021851994.1 histone H4 [Spinacia oleracea] >XP_021887636.1 histone H4 [Carica papaya] >XP_021888050.1 histone H4 [Carica papaya] >XP_021889822.1 histone H4 [Carica papaya] >XP_021892860.1 histone H4 [Carica papaya] >XP_021910298.1 histone H4 [Carica papaya] >XP_021910299.1 histone H4 [Carica papaya] >XP_021970196.1 histone H4 [Helianthus annuus] >XP_021970831.1 histone H4 [Helianthus annuus] >XP_021976787.1 histone H4 [Helianthus annuus] >XP_021977071.1 histone H4 [Helianthus annuus] >XP_021978386.1 histone H4 [Helianthus annuus] >XP_021981373.1 histone H4 [Helianthus annuus] >XP_021982247.1 histone H4 [Helianthus annuus] >XP_021982248.1 histone H4 [Helianthus annuus] >XP_021989610.1 histone H4 [Helianthus annuus] >XP_021997869.1 histone H4 [Helianthus annuus] >XP_021997872.1 histone H4 [Helianthus annuus] >XP_021997873.1 histone H4 [Helianthus annuus] >XP_021997874.1 histone H4 [Helianthus annuus] >XP_022001278.1 histone H4 [Helianthus annuus] >XP_022005182.1 histone H4 [Helianthus annuus] >XP_022008633.1 histone H4 [Helianthus annuus] >XP_022008686.1 histone H4 [Helianthus annuus] >XP_022009096.1 histone H4 [Helianthus annuus] >XP_022011720.1 histone H4 [Helianthus annuus] >XP_022013262.1 histone H4 [Helianthus annuus] >XP_022013266.1 histone H4 [Helianthus annuus] >XP_022018999.1 histone H4 [Helianthus annuus] >XP_022021488.1 histone H4 [Helianthus annuus] >XP_022024688.2 histone H4 [Helianthus annuus] >XP_022037954.1 histone H4 [Helianthus annuus] >XP_022038020.1 histone H4 [Helianthus annuus] >XP_022038534.1 histone H4 [Helianthus annuus] >XP_022038535.1 histone H4 [Helianthus annuus] >XP_022040995.1 histone H4 [Helianthus annuus] >XP_022148379.1 histone H4 [Momordica charantia] >XP_022159401.1 histone H4 [Momordica charantia] >XP_022559642.1 histone H4 [Brassica napus] >XP_022572790.1 histone H4 [Brassica napus] >XP_022574099.1 histone H4 [Brassica napus] >XP_022715401.1 histone H4 [Durio zibethinus] >XP_022728968.1 histone H4 [Durio zibethinus] >XP_022742643.1 histone H4 [Durio zibethinus] >XP_022748254.1 histone H4 [Durio zibethinus] >XP_022752765.1 histone H4 [Durio zibethinus] >XP_022752801.1 histone H4 [Durio zibethinus] >XP_022755702.1 histone H4 [Durio zibethinus] >XP_022755743.1 histone H4 [Durio zibethinus] >XP_022767521.1 histone H4 [Durio zibethinus] >XP_022847007.1 histone H4 [Olea europaea var. sylvestris] >XP_022851491.1 histone H4 [Olea europaea var. sylvestris] >XP_022865282.1 histone H4 [Olea europaea var. sylvestris] >XP_022867328.1 histone H4 [Olea europaea var. sylvestris] >XP_022868932.1 histone H4 [Olea europaea var. sylvestris] >XP_022868933.1 histone H4 [Olea europaea var. sylvestris] >XP_022869544.1 histone H4 [Olea europaea var. sylvestris] >XP_022872768.1 histone H4 [Olea europaea var. sylvestris] >XP_022873696.1 histone H4 [Olea europaea var. sylvestris] >XP_022877016.1 histone H4 [Olea europaea var. sylvestris] >XP_022887447.1 histone H4 [Olea europaea var. sylvestris] >XP_022893127.1 histone H4 [Olea europaea var. sylvestris] >XP_022893526.1 histone H4 [Olea europaea var. sylvestris] >XP_022923792.1 histone H4 [Cucurbita moschata] >XP_022943982.1 histone H4 [Cucurbita moschata] >XP_022943983.1 histone H4 [Cucurbita moschata] >XP_022944592.1 histone H4 [Cucurbita moschata] >XP_022947467.1 histone H4 [Cucurbita moschata] >XP_022947468.1 histone H4 [Cucurbita moschata] >XP_022947505.1 histone H4 [Cucurbita moschata] >XP_022947506.1 histone H4 [Cucurbita moschata] >XP_022948276.1 histone H4 [Cucurbita moschata] >XP_022964718.1 histone H4 [Cucurbita moschata] >XP_022970461.1 histone H4 [Cucurbita maxima] >XP_022986969.1 histone H4 [Cucurbita maxima] >XP_022986970.1 histone H4 [Cucurbita maxima] >XP_022986971.1 histone H4 [Cucurbita maxima] >XP_022991075.1 histone H4 [Cucurbita maxima] >XP_022998072.1 histone H4 [Cucurbita maxima] >XP_023006962.1 histone H4 [Cucurbita maxima] >XP_023006963.1 histone H4 [Cucurbita maxima] >XP_023006964.1 histone H4 [Cucurbita maxima] >XP_023006966.1 histone H4 [Cucurbita maxima] >XP_023512029.1 histone H4 [Cucurbita pepo subsp. pepo] >XP_023512030.1 histone H4 [Cucurbita pepo subsp. pepo] >XP_023512031.1 histone H4 [Cucurbita pepo subsp. pepo] >XP_023521253.1 histone H4 [Cucurbita pepo subsp. pepo] >XP_023524998.1 histone H4 [Cucurbita pepo subsp. pepo] >XP_023532330.1 histone H4 [Cucurbita pepo subsp. pepo] >XP_023532331.1 histone H4 [Cucurbita pepo subsp. pepo] >XP_023532332.1 histone H4 [Cucurbita pepo subsp. pepo] >XP_023532333.1 histone H4 [Cucurbita pepo subsp. pepo] >XP_023547129.1 histone H4 [Cucurbita pepo subsp. pepo] >XP_023638361.1 histone H4 [Capsella rubella] >XP_023730458.2 histone H4 [Lactuca sativa] >XP_023730459.1 histone H4 [Lactuca sativa] >XP_023730460.1 histone H4 [Lactuca sativa] >XP_023730461.1 histone H4 [Lactuca sativa] >XP_023730465.1 histone H4 [Lactuca sativa] >XP_023731748.1 histone H4 [Lactuca sativa] >XP_023731749.1 histone H4 [Lactuca sativa] >XP_023737272.1 histone H4 [Lactuca sativa] >XP_023737935.1 histone H4 [Lactuca sativa] >XP_023742109.1 histone H4 [Lactuca sativa] >XP_023742330.1 histone H4 [Lactuca sativa] >XP_023748101.1 histone H4 [Lactuca sativa] >XP_023748794.1 histone H4 [Lactuca sativa] >XP_023749799.1 histone H4 [Lactuca sativa] >XP_023749800.1 histone H4 [Lactuca sativa] >XP_023749801.1 histone H4 [Lactuca sativa] >XP_023750914.1 histone H4 [Lactuca sativa] >XP_023750915.1 histone H4 [Lactuca sativa] >XP_023757681.1 histone H4 [Lactuca sativa] >XP_023761034.1 histone H4 [Lactuca sativa] >XP_023761068.1 histone H4 [Lactuca sativa] >XP_023761070.1 histone H4 [Lactuca sativa] >XP_023761162.1 histone H4 [Lactuca sativa] >XP_023761163.1 histone H4 [Lactuca sativa] >XP_023765329.1 histone H4 [Lactuca sativa] >XP_023771220.1 histone H4 [Lactuca sativa] >XP_023772401.1 histone H4 [Lactuca sativa] >XP_023876250.1 histone H4 [Quercus suber] >XP_023884217.1 histone H4 [Quercus suber] >XP_023888716.1 histone H4 [Quercus suber] >XP_023904034.1 histone H4 [Quercus suber] >XP_023904035.1 histone H4 [Quercus suber] >XP_023913690.1 histone H4 [Quercus suber] >XP_023913709.1 histone H4 [Quercus suber] >XP_023913710.1 histone H4 [Quercus suber] >XP_024019744.1 histone H4 [Morus notabilis] >XP_024157215.1 histone H4 [Rosa chinensis] >XP_024157217.1 histone H4 [Rosa chinensis] >XP_024157491.1 histone H4 [Rosa chinensis] >XP_024157492.1 histone H4 [Rosa chinensis] >XP_024157493.1 histone H4 [Rosa chinensis] >XP_024173275.1 histone H4 [Rosa chinensis] >XP_024176813.1 histone H4 [Rosa chinensis] >XP_024186436.1 histone H4 [Rosa chinensis] >XP_024199218.1 histone H4 [Rosa chinensis] >XP_024360726.1 histone H4 [Physcomitrium patens] >XP_024367553.1 histone H4 [Physcomitrium patens] >XP_024373036.1 histone H4 [Physcomitrium patens] >XP_024376344.1 histone H4 [Physcomitrium patens] >XP_024377713.1 histone H4 [Physcomitrium patens] >XP_024378171.1 histone H4 [Physcomitrium patens] >XP_024378172.1 histone H4 [Physcomitrium patens] >XP_024378173.1 histone H4 [Physcomitrium patens] >XP_024378174.1 histone H4 [Physcomitrium patens] >XP_024378175.1 histone H4 [Physcomitrium patens] >XP_024378176.1 histone H4 [Physcomitrium patens] >XP_024378177.1 histone H4 [Physcomitrium patens] >XP_024378178.1 histone H4 [Physcomitrium patens] >XP_024378180.1 histone H4 [Physcomitrium patens] >XP_024378181.1 histone H4 [Physcomitrium patens] >XP_024378182.1 histone H4 [Physcomitrium patens] >XP_024378183.1 histone H4 [Physcomitrium patens] >XP_024378184.1 histone H4 [Physcomitrium patens] >XP_024378185.1 histone H4 [Physcomitrium patens] >XP_024378186.1 histone H4 [Physcomitrium patens] >XP_024378187.1 histone H4 [Physcomitrium patens] >XP_024380011.1 histone H4 [Physcomitrium patens] >XP_024392533.1 histone H4 [Physcomitrium patens] >XP_024395539.1 histone H4 [Physcomitrium patens] >XP_024397466.1 histone H4 [Physcomitrium patens] >XP_024399457.1 histone H4 [Physcomitrium patens] >XP_024462368.1 histone H4 [Populus trichocarpa] >XP_024462369.1 histone H4 [Populus trichocarpa] >XP_024462370.1 histone H4 [Populus trichocarpa] >XP_024636723.1 histone H4 [Medicago truncatula] >XP_024957437.1 histone H4 [Citrus sinensis] >XP_024960036.1 histone H4 [Cynara cardunculus var. scolymus] >XP_024961667.1 histone H4 [Cynara cardunculus var. scolymus] >XP_024961668.1 histone H4 [Cynara cardunculus var. scolymus] >XP_024964643.1 histone H4 [Cynara cardunculus var. scolymus] >XP_024964644.1 histone H4 [Cynara cardunculus var. scolymus] >XP_024965438.1 histone H4 [Cynara cardunculus var. scolymus] >XP_024965496.1 histone H4 [Cynara cardunculus var. scolymus] >XP_024967562.1 histone H4 [Cynara cardunculus var. scolymus] >XP_024969470.1 histone H4 [Cynara cardunculus var. scolymus] >XP_024974284.1 histone H4 [Cynara cardunculus var. scolymus] >XP_024974489.1 histone H4 [Cynara cardunculus var. scolymus] >XP_024982976.1 histone H4 [Cynara cardunculus var. scolymus] >XP_024989943.1 histone H4 [Cynara cardunculus var. scolymus] >XP_025607301.1 histone H4 isoform X1 [Arachis hypogaea] >XP_025607308.1 histone H4 isoform X2 [Arachis hypogaea] >XP_025607317.1 histone H4 [Arachis hypogaea] >XP_025609834.1 histone H4 [Arachis hypogaea] >XP_025630749.1 histone H4 [Arachis hypogaea] >XP_025630750.1 histone H4 [Arachis hypogaea] >XP_025630754.1 histone H4 [Arachis hypogaea] >XP_025632665.1 histone H4 [Arachis hypogaea] >XP_025632666.1 histone H4 [Arachis hypogaea] >XP_025632711.1 histone H4 [Arachis hypogaea] >XP_025638535.1 histone H4 [Arachis hypogaea] >XP_025645614.1 histone H4 [Arachis hypogaea] >XP_025646635.1 histone H4 [Arachis hypogaea] >XP_025646643.1 histone H4 [Arachis hypogaea] >XP_025646922.1 histone H4 [Arachis hypogaea] >XP_025666778.1 histone H4 [Arachis hypogaea] >XP_025690333.1 histone H4 [Arachis hypogaea] >XP_025693633.1 histone H4 [Arachis hypogaea] >XP_025794490.1 histone H4 [Panicum hallii] >XP_025795959.1 histone H4 [Panicum hallii] >XP_025800497.1 histone H4 [Panicum hallii] >XP_025800498.1 histone H4 [Panicum hallii] >XP_025803498.1 histone H4 [Panicum hallii] >XP_025807854.1 histone H4 [Panicum hallii] >XP_025812053.1 histone H4 [Panicum hallii] >XP_025814230.1 histone H4 [Panicum hallii] >XP_025823365.1 histone H4 [Panicum hallii] >XP_026377340.1 histone H4 [Papaver somniferum] >XP_026380282.1 histone H4 [Papaver somniferum] >XP_026381045.1 histone H4 [Papaver somniferum] >XP_026385473.1 histone H4 [Papaver somniferum] >XP_026386591.1 histone H4 [Papaver somniferum] >XP_026390314.1 histone H4 [Papaver somniferum] >XP_026390423.1 histone H4 [Papaver somniferum] >XP_026391397.1 histone H4 [Papaver somniferum] >XP_026393189.1 histone H4 [Papaver somniferum] >XP_026400042.1 histone H4 [Papaver somniferum] >XP_026408652.1 histone H4 [Papaver somniferum] >XP_026408653.1 histone H4 [Papaver somniferum] >XP_026409546.1 histone H4 [Papaver somniferum] >XP_026409586.1 histone H4 [Papaver somniferum] >XP_026409782.1 histone H4 [Papaver somniferum] >XP_026411386.1 histone H4 [Papaver somniferum] >XP_026411952.1 histone H4 [Papaver somniferum] >XP_026414678.1 histone H4 [Papaver somniferum] >XP_026414680.1 histone H4 [Papaver somniferum] >XP_026415333.1 histone H4 [Papaver somniferum] >XP_026418415.1 histone H4 [Papaver somniferum] >XP_026418445.1 histone H4 [Papaver somniferum] >XP_026422766.1 histone H4 [Papaver somniferum] >XP_026422825.1 histone H4 [Papaver somniferum] >XP_026423083.1 histone H4 [Papaver somniferum] >XP_026423157.1 histone H4 [Papaver somniferum] >XP_026423326.1 histone H4 [Papaver somniferum] >XP_026427114.1 histone H4 [Papaver somniferum] >XP_026430270.1 histone H4 [Papaver somniferum] >XP_026431165.1 histone H4 [Papaver somniferum] >XP_026436344.1 histone H4 [Papaver somniferum] >XP_026436875.1 histone H4 [Papaver somniferum] >XP_026436908.1 histone H4 [Papaver somniferum] >XP_026437029.1 histone H4 [Papaver somniferum] >XP_026439986.1 histone H4 [Papaver somniferum] >XP_026440014.1 histone H4 [Papaver somniferum] >XP_026440075.1 histone H4 [Papaver somniferum] >XP_026440147.1 histone H4 [Papaver somniferum] >XP_026443362.1 histone H4 [Papaver somniferum] >XP_026445465.1 histone H4 [Papaver somniferum] >XP_026454862.1 histone H4 [Papaver somniferum] >XP_026460746.1 histone H4 [Papaver somniferum] >XP_027069475.1 histone H4 [Coffea arabica] >XP_027087444.1 histone H4 [Coffea arabica] >XP_027088047.1 histone H4 [Coffea arabica] >XP_027088155.1 histone H4 [Coffea arabica] >XP_027102377.1 histone H4 [Coffea arabica] >XP_027104488.1 histone H4 [Coffea arabica] >XP_027104577.1 histone H4 [Coffea arabica] >XP_027108710.1 histone H4 [Coffea arabica] >XP_027111031.1 histone H4 [Coffea arabica] >XP_027111138.1 histone H4 [Coffea arabica] >XP_027111139.1 histone H4 [Coffea arabica] >XP_027159884.1 histone H4 [Coffea eugenioides] >XP_027162333.1 histone H4 [Coffea eugenioides] >XP_027162340.1 histone H4 [Coffea eugenioides] >XP_027164044.1 histone H4 [Coffea eugenioides] >XP_027175284.1 histone H4 [Coffea eugenioides] >XP_027177500.1 histone H4 [Coffea eugenioides] >XP_027184725.1 histone H4 [Coffea eugenioides] >XP_027329264.1 histone H4 isoform X1 [Abrus precatorius] >XP_027329266.1 histone H4 [Abrus precatorius] >XP_027333087.1 histone H4 [Abrus precatorius] >XP_027334015.1 histone H4 [Abrus precatorius] >XP_027341082.1 histone H4 isoform X1 [Abrus precatorius] >XP_027345737.1 histone H4 isoform X1 [Abrus precatorius] >XP_027350500.1 histone H4 isoform X1 [Abrus precatorius] >XP_027909567.1 histone H4 [Vigna unguiculata] >XP_027910437.1 histone H4 [Vigna unguiculata] >XP_027910438.1 histone H4 [Vigna unguiculata] >XP_027910486.1 histone H4 [Vigna unguiculata] >XP_027912666.1 histone H4 [Vigna unguiculata] >XP_027916591.1 histone H4 [Vigna unguiculata] >XP_027916938.1 histone H4 [Vigna unguiculata] >XP_027926225.1 histone H4 [Vigna unguiculata] >XP_027939150.1 histone H4 [Vigna unguiculata] >XP_028051240.1 histone H4 [Camellia sinensis] >XP_028058345.1 histone H4 [Camellia sinensis] >XP_028079576.1 histone H4 [Camellia sinensis] >XP_028081974.1 histone H4 [Camellia sinensis] >XP_028095804.1 histone H4 [Camellia sinensis] >XP_028096887.1 histone H4 [Camellia sinensis] >XP_028096894.1 histone H4 [Camellia sinensis] >XP_028124032.1 histone H4 [Camellia sinensis] >XP_028182821.1 histone H4 [Glycine soja] >XP_028187861.1 histone H4 [Glycine soja] >XP_028187919.1 histone H4 [Glycine soja] >XP_028190210.1 histone H4 [Glycine soja] >XP_028190653.1 histone H4 [Glycine soja] >XP_028190654.1 histone H4 [Glycine soja] >XP_028192745.1 histone H4 [Glycine soja] >XP_028196318.1 histone H4 [Glycine soja] >XP_028198490.1 histone H4 [Glycine soja] >XP_028208937.1 histone H4 [Glycine soja] >XP_028212973.1 histone H4 [Glycine soja] >XP_028214204.1 histone H4 [Glycine soja] >XP_028219977.1 histone H4 [Glycine soja] >XP_028225704.1 histone H4 [Glycine soja] >XP_028762951.1 histone H4 [Prosopis alba] >XP_028765590.1 histone H4 [Prosopis alba] >XP_028775363.1 histone H4 [Prosopis alba] >XP_028775625.1 histone H4 [Prosopis alba] >XP_028794500.1 histone H4 [Prosopis alba] >XP_030440156.1 histone H4 [Syzygium oleosum] >XP_030441440.1 histone H4 [Syzygium oleosum] >XP_030450038.1 histone H4 [Syzygium oleosum] >XP_030450046.1 histone H4 [Syzygium oleosum] >XP_030473723.1 histone H4 [Syzygium oleosum] >XP_030481652.1 histone H4 [Cannabis sativa] >XP_030500841.1 histone H4 [Cannabis sativa] >XP_030500842.1 histone H4 [Cannabis sativa] >XP_030501782.1 histone H4 [Cannabis sativa] >XP_030504818.1 histone H4 [Cannabis sativa] >XP_030510313.1 histone H4 [Cannabis sativa] >XP_030510314.1 histone H4 [Cannabis sativa] >XP_030510451.1 histone H4 [Cannabis sativa] >XP_030510452.1 histone H4 [Cannabis sativa] >XP_030510768.1 histone H4 [Cannabis sativa] >XP_030510769.1 histone H4 [Cannabis sativa] >XP_030510770.1 histone H4 [Cannabis sativa] >XP_030510771.1 histone H4 [Cannabis sativa] >XP_030510772.1 histone H4 [Cannabis sativa] >XP_030510999.1 histone H4 [Cannabis sativa] >XP_030511000.1 histone H4 [Cannabis sativa] >XP_030514291.1 histone H4 [Rhodamnia argentea] >XP_030518567.1 histone H4 [Rhodamnia argentea] >XP_030518569.1 histone H4 [Rhodamnia argentea] >XP_030524437.1 histone H4 [Rhodamnia argentea] >XP_030529009.1 histone H4 [Rhodamnia argentea] >XP_030537255.1 histone H4 [Rhodamnia argentea] >XP_030542518.1 histone H4 [Rhodamnia argentea] >XP_030551767.1 histone H4 [Rhodamnia argentea] >XP_030929153.1 histone H4 [Quercus lobata] >XP_030929154.1 histone H4 [Quercus lobata] >XP_030931499.1 histone H4 [Quercus lobata] >XP_030955128.1 histone H4 [Quercus lobata] >XP_030955130.1 histone H4 [Quercus lobata] >XP_030966967.1 histone H4 [Quercus lobata] >XP_030967695.1 histone H4 [Quercus lobata] >XP_031112405.1 histone H4 [Ipomoea triloba] >XP_031112871.1 histone H4 [Ipomoea triloba] >XP_031112873.1 histone H4 [Ipomoea triloba] >XP_031127099.1 histone H4 [Ipomoea triloba] >XP_031127326.1 histone H4 [Ipomoea triloba] >XP_031255519.1 histone H4 [Pistacia vera] >XP_031268215.1 histone H4 [Pistacia vera] >XP_031271776.1 histone H4 [Pistacia vera] >XP_031275969.1 histone H4 [Pistacia vera] >XP_031276200.1 histone H4 [Pistacia vera] >XP_031375297.1 histone H4 [Punica granatum] >XP_031377134.1 histone H4 [Punica granatum] >XP_031384541.1 histone H4 [Punica granatum] >XP_031384937.1 histone H4 [Punica granatum] >XP_031398211.1 histone H4 [Punica granatum] >XP_031400345.1 histone H4 [Punica granatum] >XP_031401508.1 histone H4 [Punica granatum] >XP_031476751.1 histone H4 [Nymphaea colorata] >XP_031483440.1 histone H4 [Nymphaea colorata] >XP_031486406.1 histone H4 [Nymphaea colorata] >XP_031487146.1 histone H4 [Nymphaea colorata] >XP_031495179.1 histone H4 [Nymphaea colorata] >XP_031498070.1 histone H4 [Nymphaea colorata] >XP_031502388.1 histone H4 [Nymphaea colorata] >XP_033128652.1 histone H4 [Brassica rapa] >XP_034203043.1 histone H4 [Prunus dulcis] >XP_034203044.1 histone H4 [Prunus dulcis] >XP_034217873.1 histone H4 [Prunus dulcis] >XP_034222398.1 histone H4 [Prunus dulcis] >XP_034222646.1 histone H4 [Prunus dulcis] >XP_034224440.1 histone H4 [Prunus dulcis] >XP_034568479.1 histone H4 [Setaria viridis] >XP_034571439.1 histone H4 [Setaria viridis] >XP_034574138.1 histone H4 [Setaria viridis] >XP_034578403.1 histone H4 [Setaria viridis] >XP_034581974.1 histone H4 [Setaria viridis] >XP_034588554.1 histone H4 [Setaria viridis] >XP_034592959.1 histone H4 [Setaria viridis] >XP_034599042.1 histone H4 [Setaria viridis] >XP_034604451.1 histone H4 [Setaria viridis] >XP_034687215.1 histone H4 [Vitis riparia] >XP_034688495.1 histone H4 [Vitis riparia] >XP_034692776.1 histone H4 [Vitis riparia] >XP_034703086.1 histone H4 [Vitis riparia] >XP_034703122.1 histone H4 [Vitis riparia] >XP_034889668.1 histone H4 [Populus alba] >XP_034893087.1 histone H4 [Populus alba] >XP_034918114.1 histone H4 [Populus alba] >XP_034918115.1 histone H4 [Populus alba] >XP_034918116.1 histone H4 [Populus alba] >XP_034919018.1 histone H4 [Populus alba] >XP_034932965.1 histone H4 [Populus alba] >XP_034932977.1 histone H4 [Populus alba] >XP_034932978.1 histone H4 [Populus alba] >XP_035846140.1 histone H4 [Helianthus annuus] >XP_035846547.1 histone H4 [Helianthus annuus] >XP_037404806.1 histone H4 [Triticum dicoccoides] >XP_037407169.1 histone H4 [Triticum dicoccoides] >XP_037407250.1 histone H4 [Triticum dicoccoides] >XP_037410856.1 histone H4 [Triticum dicoccoides] >XP_037412190.1 histone H4 [Triticum dicoccoides] >XP_037414622.1 histone H4 [Triticum dicoccoides] >XP_037418812.1 histone H4 [Triticum dicoccoides] >XP_037418814.1 histone H4 [Triticum dicoccoides] >XP_037418894.1 histone H4 [Triticum dicoccoides] >XP_037418917.1 histone H4 [Triticum dicoccoides] >XP_037420227.1 histone H4 [Triticum dicoccoides] >XP_037424256.1 histone H4 [Triticum dicoccoides] >XP_037424426.1 histone H4 [Triticum dicoccoides] >XP_037425584.1 histone H4 [Triticum dicoccoides] >XP_037434528.1 histone H4 [Triticum dicoccoides] >XP_037435736.1 histone H4 [Triticum dicoccoides] >XP_037435738.1 histone H4 [Triticum dicoccoides] >XP_037435743.1 histone H4 [Triticum dicoccoides] >XP_037435773.1 histone H4 [Triticum dicoccoides] >XP_037441410.1 histone H4 [Triticum dicoccoides] >XP_037442673.1 histone H4 [Triticum dicoccoides] >XP_037443000.1 histone H4 [Triticum dicoccoides] >XP_037443001.1 histone H4 [Triticum dicoccoides] >XP_037443002.1 histone H4 [Triticum dicoccoides] >XP_037443008.1 histone H4 [Triticum dicoccoides] >XP_037443052.1 histone H4 [Triticum dicoccoides] >XP_037444938.1 histone H4 [Triticum dicoccoides] >XP_037444978.1 histone H4 [Triticum dicoccoides] >XP_037444981.1 histone H4 [Triticum dicoccoides] >XP_037444982.1 histone H4 [Triticum dicoccoides] >XP_037444985.1 histone H4 [Triticum dicoccoides] >XP_037445012.1 histone H4 [Triticum dicoccoides] >XP_037445025.1 histone H4 [Triticum dicoccoides] >XP_037445027.1 histone H4 [Triticum dicoccoides] >XP_037445289.1 histone H4 [Triticum dicoccoides] >XP_037452661.1 histone H4 [Triticum dicoccoides] >XP_037453092.1 histone H4 [Triticum dicoccoides] >XP_037453308.1 histone H4 [Triticum dicoccoides] >XP_037453746.1 histone H4 [Triticum dicoccoides] >XP_037453804.1 histone H4 [Triticum dicoccoides] >XP_037453823.1 histone H4 [Triticum dicoccoides] >XP_037454364.1 histone H4 [Triticum dicoccoides] >XP_037454616.1 histone H4 [Triticum dicoccoides] >XP_037454868.1 histone H4 [Triticum dicoccoides] >XP_037454870.1 histone H4 [Triticum dicoccoides] >XP_037454946.1 histone H4 [Triticum dicoccoides] >XP_037455355.1 histone H4 [Triticum dicoccoides] >XP_037455517.1 histone H4 [Triticum dicoccoides] >XP_037455662.1 histone H4 [Triticum dicoccoides] >XP_037455923.1 histone H4 [Triticum dicoccoides] >XP_037456061.1 histone H4 [Triticum dicoccoides] >XP_037456663.1 histone H4 [Triticum dicoccoides] >XP_037466339.1 histone H4 [Triticum dicoccoides] >XP_037470921.1 histone H4 [Triticum dicoccoides] >XP_037472233.1 histone H4 [Triticum dicoccoides] >XP_037472239.1 histone H4 [Triticum dicoccoides] >XP_037472486.1 histone H4 [Triticum dicoccoides] >XP_037473153.1 histone H4 [Triticum dicoccoides] >XP_037478997.1 histone H4 [Triticum dicoccoides] >XP_037478998.1 histone H4 [Triticum dicoccoides] >XP_037479405.1 histone H4 [Triticum dicoccoides] >XP_037485339.1 histone H4 [Triticum dicoccoides] >XP_037486835.1 histone H4 [Triticum dicoccoides] >XP_037489394.1 histone H4 [Triticum dicoccoides] >XP_037489565.1 histone H4 [Triticum dicoccoides] >XP_038689074.1 histone H4 [Tripterygium wilfordii] >XP_038694989.1 histone H4 [Tripterygium wilfordii] >XP_038698626.1 histone H4 [Tripterygium wilfordii] >XP_038701623.1 histone H4 [Tripterygium wilfordii] >XP_038705916.1 histone H4 [Tripterygium wilfordii] >XP_038706241.1 histone H4 [Tripterygium wilfordii] >XP_038712230.1 histone H4 [Tripterygium wilfordii] >XP_038713469.1 histone H4 [Tripterygium wilfordii] >XP_038726294.1 histone H4 [Tripterygium wilfordii] >XP_038726304.1 histone H4 [Tripterygium wilfordii] >XP_038885308.1 histone H4 [Benincasa hispida] >XP_038885309.1 histone H4 [Benincasa hispida] >XP_038893927.1 histone H4 [Benincasa hispida] >XP_038901406.1 histone H4 [Benincasa hispida] >XP_038901407.1 histone H4 [Benincasa hispida] >XP_038901992.1 histone H4 [Benincasa hispida] >XP_038901993.1 histone H4 [Benincasa hispida] >XP_038990790.1 histone H4 [Hibiscus syriacus] >XP_038993090.1 histone H4 [Hibiscus syriacus] >XP_039002351.1 histone H4 [Hibiscus syriacus] >XP_039004462.1 histone H4 [Hibiscus syriacus] >XP_039008586.1 histone H4 [Hibiscus syriacus] >XP_039012887.1 histone H4 [Hibiscus syriacus] >XP_039012888.1 histone H4 [Hibiscus syriacus] >XP_039013059.1 histone H4 [Hibiscus syriacus] >XP_039013445.1 histone H4 [Hibiscus syriacus] >XP_039017299.1 histone H4 [Hibiscus syriacus] >XP_039019499.1 histone H4 [Hibiscus syriacus] >XP_039021814.1 histone H4 [Hibiscus syriacus] >XP_039026392.1 histone H4 [Hibiscus syriacus] >XP_039027905.1 histone H4 [Hibiscus syriacus] >XP_039028632.1 histone H4 [Hibiscus syriacus] >XP_039037602.1 histone H4 [Hibiscus syriacus] >XP_039041551.1 histone H4 [Hibiscus syriacus] >XP_039042059.1 histone H4 [Hibiscus syriacus] >XP_039043510.1 histone H4 [Hibiscus syriacus] >XP_039043519.1 histone H4 [Hibiscus syriacus] >XP_039045621.1 histone H4 [Hibiscus syriacus] >XP_039047655.1 histone H4 [Hibiscus syriacus] >XP_039052195.1 histone H4 [Hibiscus syriacus] >XP_039059933.1 histone H4 [Hibiscus syriacus] >XP_039063769.1 histone H4 [Hibiscus syriacus] >XP_039068057.1 histone H4 [Hibiscus syriacus] >XP_039128316.1 histone H4 [Dioscorea cayenensis subsp. rotundata] >XP_039131758.1 histone H4 [Dioscorea cayenensis subsp. rotundata] >XP_039134504.1 histone H4 [Dioscorea cayenensis subsp. rotundata] >XP_039136353.1 histone H4 [Dioscorea cayenensis subsp. rotundata] >XP_039136615.1 histone H4 [Dioscorea cayenensis subsp. rotundata] >XP_039144340.1 histone H4 [Dioscorea cayenensis subsp. rotundata] >XP_039167727.1 histone H4 [Eucalyptus grandis] >XP_039773675.1 histone H4 [Panicum virgatum] >XP_039780296.1 histone H4 [Panicum virgatum] >XP_039785408.1 histone H4 [Panicum virgatum] >XP_039790735.1 histone H4 [Panicum virgatum] >XP_039795304.1 histone H4 [Panicum virgatum] >XP_039795305.1 histone H4 [Panicum virgatum] >XP_039795307.1 histone H4 [Panicum virgatum] >XP_039800615.1 histone H4 [Panicum virgatum] >XP_039817072.1 histone H4 [Panicum virgatum] >XP_039821305.1 histone H4 [Panicum virgatum] >XP_039824462.1 histone H4 [Panicum virgatum] >XP_039828883.1 histone H4 [Panicum virgatum] >XP_039831265.1 histone H4 [Panicum virgatum] >XP_039837919.1 histone H4 [Panicum virgatum] >XP_039849841.1 histone H4 [Panicum virgatum] >XP_039854601.1 histone H4 [Panicum virgatum] >XP_039855477.1 histone H4 [Panicum virgatum] >XP_040260346.1 histone H4 [Aegilops tauschii subsp. strangulata] >XP_040376765.1 histone H4 [Oryza brachyantha] >XP_040377834.1 histone H4 [Oryza brachyantha] >XP_040381912.1 histone H4 [Oryza brachyantha] >XP_040383999.1 histone H4 [Oryza brachyantha] >XP_040931422.1 histone H4 [Gossypium hirsutum] >XP_040943642.1 histone H4 [Gossypium hirsutum] >XP_040958816.1 histone H4 [Gossypium hirsutum] >XP_040965594.1 histone H4 [Gossypium hirsutum] >XP_040965603.1 histone H4 [Gossypium hirsutum] >XP_040991865.1 histone H4 [Juglans microcarpa x Juglans regia] >XP_040993348.1 histone H4 [Juglans microcarpa x Juglans regia] >XP_040994070.1 histone H4 [Juglans microcarpa x Juglans regia] >XP_041011875.1 histone H4 [Juglans microcarpa x Juglans regia] >XP_041025620.1 histone H4 [Juglans microcarpa x Juglans regia] >XP_041026793.1 histone H4 [Juglans microcarpa x Juglans regia] >XP_041996632.1 histone H4 [Salvia splendens] >XP_041996812.1 histone H4 [Salvia splendens] >XP_041999110.1 histone H4 [Salvia splendens] >XP_042000959.1 histone H4 [Salvia splendens] >XP_042021944.1 histone H4 [Salvia splendens] >XP_042026485.1 histone H4 [Salvia splendens] >XP_042034652.1 histone H4 [Salvia splendens] >XP_042038078.1 histone H4 [Salvia splendens] >XP_042039157.1 histone H4 [Salvia splendens] >XP_042039657.1 histone H4 [Salvia splendens] >XP_042040063.1 histone H4 [Salvia splendens] >XP_042040166.1 histone H4 [Salvia splendens] >XP_042040192.1 histone H4 [Salvia splendens] >XP_042041077.1 histone H4 [Salvia splendens] >XP_042046097.1 histone H4 [Salvia splendens] >XP_042047589.1 histone H4 [Salvia splendens] >XP_042048937.1 histone H4 [Salvia splendens] >XP_042054187.1 histone H4 [Salvia splendens] >XP_042057979.1 histone H4 [Salvia splendens] >XP_042062743.1 histone H4 [Salvia splendens] >XP_042378552.1 histone H4 [Zingiber officinale] >XP_042380670.1 histone H4 [Zingiber officinale] >XP_042384327.1 histone H4 [Zingiber officinale] >XP_042385913.1 histone H4 [Zingiber officinale] >XP_042411415.1 histone H4 [Zingiber officinale] >XP_042416152.1 histone H4 [Zingiber officinale] >XP_042419989.1 histone H4 [Zingiber officinale] >XP_042422755.1 histone H4 [Zingiber officinale] >XP_042428777.1 histone H4 [Zingiber officinale] >XP_042428786.1 histone H4 [Zingiber officinale] >XP_042428796.1 histone H4 [Zingiber officinale] >XP_042428807.1 histone H4 [Zingiber officinale] >XP_042430175.1 histone H4 [Zingiber officinale] >XP_042431308.1 histone H4 [Zingiber officinale] >XP_042431795.1 histone H4 [Zingiber officinale] >XP_042433313.1 histone H4 [Zingiber officinale] >XP_042433327.1 histone H4 [Zingiber officinale] >XP_042433339.1 histone H4 [Zingiber officinale] >XP_042455777.1 histone H4 [Zingiber officinale] >XP_042458846.1 histone H4 [Zingiber officinale] >XP_042460779.1 histone H4 [Zingiber officinale] >XP_042460780.1 histone H4 [Zingiber officinale] >XP_042461010.1 histone H4 [Zingiber officinale] >XP_042461011.1 histone H4 [Zingiber officinale] >XP_042464226.1 histone H4 [Zingiber officinale] >XP_042464740.1 histone H4 [Zingiber officinale] >XP_042464753.1 histone H4 [Zingiber officinale] >XP_042464761.1 histone H4 [Zingiber officinale] >XP_042467037.1 histone H4 [Zingiber officinale] >XP_042468350.1 histone H4 [Zingiber officinale] >XP_042468365.1 histone H4 [Zingiber officinale] >XP_042468801.1 histone H4 [Zingiber officinale] >XP_042471754.1 histone H4 [Zingiber officinale] >XP_042473952.1 histone H4 [Zingiber officinale] >XP_042475956.1 histone H4 [Macadamia integrifolia] >XP_042476833.1 histone H4 [Macadamia integrifolia] >XP_042477842.1 histone H4 [Macadamia integrifolia] >XP_042480269.1 histone H4 [Macadamia integrifolia] >XP_042500371.1 histone H4 [Macadamia integrifolia] >XP_042500410.1 histone H4 [Macadamia integrifolia] >XP_042503312.1 histone H4 [Macadamia integrifolia] >XP_042503527.1 histone H4 [Macadamia integrifolia] >XP_042504585.1 histone H4 [Macadamia integrifolia] >XP_042943816.1 histone H4 [Carya illinoinensis] >XP_042944118.1 histone H4 [Carya illinoinensis] >XP_042954765.1 histone H4 [Carya illinoinensis] >XP_042957532.1 histone H4 [Carya illinoinensis] >XP_042957762.1 histone H4 [Carya illinoinensis] >XP_042959702.1 histone H4 [Carya illinoinensis] >XP_042980531.1 histone H4 [Carya illinoinensis] >P0CG89.1 RecName: Full=Histone H4 [Glycine max] >P59259.2 RecName: Full=Histone H4 [Arabidopsis thaliana] >P62785.2 RecName: Full=Histone H4 variant TH011 [Triticum aestivum] >P62787.2 RecName: Full=Histone H4 [Zea mays] >P62788.2 RecName: Full=Histone H4 [Pisum sativum] >P62887.2 RecName: Full=Histone H4 [Lolium temulentum] >Q6LAF3.3 RecName: Full=Histone H4 [Flaveria trinervia] >Q6PMI5.3 RecName: Full=Histone H4 [Chelidonium majus] >Q6WZ83.3 RecName: Full=Histone H4 [Eucalyptus globulus] >Q76H85.3 RecName: Full=Histone H4 [Silene latifolia] >AAX92702.1 histone 4 [Picea abies] >ABK20879.1 unknown [Picea sitchensis] >ABQ32303.1 putative histone H4-like protein [Artemisia annua] >ABW81095.1 H4his18 [Tarenaya spinosa] >AEW08074.1 hypothetical protein 0_18315_01 [Pinus radiata] >AFG63669.1 hypothetical protein 0_18315_01 [Pinus taeda] >AFK36911.1 unknown [Lotus japonicus] >AIZ04727.1 histone 4 [Elettaria cardamomum] >AIZ04728.1 histone 4 [Nicotiana benthamiana] >APR64201.1 histone H4 family protein [Populus tomentosa] >AYN07275.1 histone H4 [Eucommia ulmoides] >EAY76410.1 hypothetical protein OsI_04340 [Oryza sativa Indica Group] >EHA8589389.1 Histone H4 [Cocos nucifera] >EMS51036.1 Histone H4 [Triticum urartu] >EPS60847.1 hypothetical protein M569_13955 [Genlisea aurea] >KAA0052020.1 histone H4 [Cucumis melo var. makuwa] >KAA3456733.1 histone H4 [Gossypium australe] >KAA8522767.1 hypothetical protein F0562_009071 [Nyssa sinensis] >KAB1216306.1 Histone H4 [Morella rubra] >KAB1996942.1 hypothetical protein ES319_D13G266400v1 [Gossypium barbadense] >KAB2598218.1 hypothetical protein D8674_001138 [Pyrus ussuriensis x Pyrus communis] >KAB5514395.1 hypothetical protein DKX38_028301 [Salix brachista] >KAB8084191.1 hypothetical protein EE612_006684 [Oryza sativa] >KAD3337957.1 hypothetical protein E3N88_33478 [Mikania micrantha] >KAE7996811.1 hypothetical protein FH972_001501 [Carpinus fangiana] >KAE8768072.1 Histone H4 [Hordeum vulgare] >KAE9447824.1 hypothetical protein C3L33_20287, partial [Rhododendron williamsianum] >KAE9585496.1 Histone H4 [Lupinus albus] >KAF0891206.1 hypothetical protein E2562_009392 [Oryza meyeriana var. granulata] >KAF2555213.1 hypothetical protein F2Q68_00013031 [Brassica cretica] >KAF3321933.1 Histone H4 [Carex littledalei] >KAF3433738.1 hypothetical protein FNV43_RR24841 [Rhamnella rubrinervis] >KAF3776700.1 Histone H4 [Nymphaea thermarum] >KAF3955580.1 hypothetical protein CMV_019218 [Castanea mollissima] >KAF5184023.1 Histone h4 [Thalictrum thalictroides] >KAF6138450.1 hypothetical protein GIB67_022484 [Kingdonia uniflora] >KAF7119965.1 hypothetical protein RHSIM_Rhsim13G0085400 [Rhododendron simsii] >KAF7806628.1 histone H4 [Senna tora] >KAF7846793.1 hypothetical protein BT93_L3732 [Corymbia citriodora subsp. variegata] >KAF8052881.1 hypothetical protein N665_1495s0012 [Sinapis alba] >KAF8365072.1 hypothetical protein HHK36_032924 [Tetracentron sinense] >KAF9597620.1 hypothetical protein IFM89_020099 [Coptis chinensis] >KAF9676757.1 hypothetical protein SADUNF_Sadunf08G0036100 [Salix dunnii] >KAF9827189.1 hypothetical protein H0E87_016801 [Populus deltoides] >KAG0450805.1 hypothetical protein HPP92_026753 [Vanilla planifolia] >KAG0504687.1 hypothetical protein M758_N026100 [Ceratodon purpureus] >KAG2254569.1 hypothetical protein Bca52824_084705 [Brassica carinata] >KAG5219205.1 histone [Salix suchowensis] >KAG5391568.1 hypothetical protein IGI04_021531 [Brassica rapa subsp. trilocularis] >KAG5515353.1 hypothetical protein RHGRI_036410 [Rhododendron griersonianum] >KAG6570720.1 hypothetical protein SDJN03_29635, partial [Cucurbita argyrosperma subsp. sororia] >KAG7010566.1 hypothetical protein SDJN02_27360, partial [Cucurbita argyrosperma subsp. argyrosperma] >KAG7528703.1 CENP-T/Histone H4 histone fold [Arabidopsis thaliana x Arabidopsis arenosa] >KAG7538580.1 CENP-T/Histone H4 histone fold [Arabidopsis suecica] >KAG8044653.1 hypothetical protein GUJ93_ZPchr0395g29028 [Zizania palustris] >KAG8364698.1 hypothetical protein BUALT_Bualt18G0025600 [Buddleja alternifolia] >KAG8484787.1 hypothetical protein CXB51_021534 [Gossypium anomalum] >KAG9128805.1 hypothetical protein Leryth_009565 [Lithospermum erythrorhizon] >KAG9442334.1 hypothetical protein H6P81_018188 [Aristolochia fimbriata] >KFK27507.1 hypothetical protein AALP_AA8G392100 [Arabis alpina] >KZV19615.1 hypothetical protein F511_10518 [Dorcoceras hygrometricum] >MBA0551479.1 hypothetical protein [Gossypium lobatum] >MBA0608082.1 hypothetical protein [Gossypium davidsonii] >MBA0644413.1 hypothetical protein [Gossypium klotzschianum] >MBA0678670.1 hypothetical protein [Gossypium aridum] >MBA0708333.1 hypothetical protein [Gossypium laxum] >MBA0735726.1 hypothetical protein [Gossypium gossypioides] >MBA0760665.1 hypothetical protein [Gossypium trilobum] >MBA0793576.1 hypothetical protein [Gossypium harknessii] >MBA0824207.1 hypothetical protein [Gossypium armourianum] >MBA0851133.1 hypothetical protein [Gossypium schwendimanii] >MBC9826863.1 hypothetical protein [Adiantum capillus-veneris] >MQL87109.1 hypothetical protein [Colocasia esculenta] >OEL16490.1 Histone H4 [Dichanthelium oligosanthes] >OMO58938.1 Histone H4 [Corchorus capsularis] >OMO91301.1 Histone H4 [Corchorus olitorius] >OVA04044.1 Histone H4 [Macleaya cordata] >PHT44726.1 Histone H4 [Capsicum baccatum] >PHU13756.1 Histone H4 [Capsicum chinense] >PIA26147.1 hypothetical protein AQUCO_09600005v1 [Aquilegia coerulea] >PIM97155.1 Histone H4 [Handroanthus impetiginosus] >PKA48253.1 Histone H4 [Apostasia shenzhenica] >PNX84124.1 histone H4-like protein [Trifolium pratense] >PON37756.1 Histone H [Parasponia andersonii] >PON51449.1 Histone H [Trema orientale] >PQM38729.1 histone H4 [Prunus yedoensis var. nudiflora] >PSR86651.1 Histone H4 variant like [Actinidia chinensis var. chinensis] >PUZ40350.1 hypothetical protein GQ55_9G416200 [Panicum hallii var. hallii] >RAL37445.1 hypothetical protein DM860_000139 [Cuscuta australis] >RDY04919.1 hypothetical protein CR513_11300, partial [Mucuna pruriens] >RLM64861.1 histone H4 [Panicum miliaceum] >RRT34934.1 hypothetical protein B296_00049229 [Ensete ventricosum] >RWR75312.1 histone H4 [Cinnamomum micranthum f. kanehirae] >THU46332.1 hypothetical protein C4D60_Mb09t03800 [Musa balbisiana] >TKY45382.1 Histone H4 [Spatholobus suberectus] >TMW83156.1 hypothetical protein EJD97_002708 [Solanum chilense] >TQD93050.1 hypothetical protein C1H46_021364 [Malus baccata] >TVU09648.1 hypothetical protein EJB05_43135, partial [Eragrostis curvula] >TXG74018.1 hypothetical protein EZV62_002597 [Acer yangbiense] >TYG39144.1 hypothetical protein ES288_D13G280900v1 [Gossypium darwinii] >TYH36658.1 hypothetical protein ES332_D13G279000v1 [Gossypium tomentosum] >TYI48797.1 hypothetical protein E1A91_D13G272500v1 [Gossypium mustelinum] >CAA2615085.1 unnamed protein product [Spirodela intermedia] >CAA2966792.1 histone H4 [Olea europaea subsp. europaea] >CAA7017700.1 unnamed protein product [Microthlaspi erraticum] >CAB01914.1 histone H4 homologue [Sesbania rostrata] >CAB3453452.1 unnamed protein product [Digitaria exilis] >CAB4077364.1 unnamed protein product [Lactuca saligna] >CAB4270653.1 unnamed protein product [Prunus armeniaca] >CAD6201666.1 unnamed protein product [Miscanthus lutarioriparius] >CAE5956814.1 unnamed protein product [Arabidopsis arenosa] >CCI55324.1 PH01B001I13.20 [Phyllostachys edulis] >CDP00010.1 unnamed protein product [Coffea canephora] >CUT18458.1 H4 [Lilium davidii var. unicolor] >VAH05853.1 unnamed protein product [Triticum turgidum subsp. durum] >VDC87343.1 unnamed protein product [Brassica oleracea] >VFQ63785.1 unnamed protein product [Cuscuta campestris] >VVB16618.1 unnamed protein product [Arabis nemorensis] >BAA85120.1 histone H4-like protein [Solanum melongena] >BAD82897.1 histone H4, partial [Fragaria x ananassa] >BAJ86564.1 predicted protein [Hordeum vulgare subsp. vulgare] >BAQ19379.1 histone H4 [Sarracenia purpurea] >BAT74750.1 hypothetical protein VIGAN_01249700 [Vigna angularis var. angularis] >GAV71402.1 Histone domain-containing protein [Cephalotus follicularis] >GAY37149.1 hypothetical protein CUMW_026840 [Citrus unshiu] >GER26665.1 histone H4 [Striga asiatica] >GEU43579.1 histone H4 [Tanacetum cinerariifolium] >GFP90154.1 histone h4 [Phtheirospermum japonicum] >GFS32057.1 histone superfamily protein [Actinidia rufa]) HSP 1 Score: 198 bits (504), Expect = 7.30e-64 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of MC02g_new0139 vs. NCBI nr
Match: GAV57897.1 (Histone domain-containing protein, partial [Cephalotus follicularis] >GAV63738.1 Histone domain-containing protein, partial [Cephalotus follicularis]) HSP 1 Score: 198 bits (504), Expect = 7.53e-64 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of MC02g_new0139 vs. NCBI nr
Match: KAF0905845.1 (hypothetical protein E2562_008880 [Oryza meyeriana var. granulata]) HSP 1 Score: 198 bits (504), Expect = 7.53e-64 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of MC02g_new0139 vs. NCBI nr
Match: GAV62703.1 (Histone domain-containing protein, partial [Cephalotus follicularis]) HSP 1 Score: 198 bits (504), Expect = 7.78e-64 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of MC02g_new0139 vs. NCBI nr
Match: KAF3779239.1 (Histone H4 [Nymphaea thermarum]) HSP 1 Score: 198 bits (504), Expect = 7.78e-64 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of MC02g_new0139 vs. ExPASy TrEMBL
Match: K3YX00 (Histone H4 OS=Setaria italica OX=4555 GN=101768337 PE=3 SV=1) HSP 1 Score: 198 bits (504), Expect = 3.53e-64 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of MC02g_new0139 vs. ExPASy TrEMBL
Match: A0A2G9H387 (Histone H4 OS=Handroanthus impetiginosus OX=429701 GN=CDL12_07454 PE=3 SV=1) HSP 1 Score: 198 bits (504), Expect = 3.53e-64 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of MC02g_new0139 vs. ExPASy TrEMBL
Match: A0A7I8LBC1 (Histone H4 OS=Spirodela intermedia OX=51605 GN=SI7747_01001442 PE=3 SV=1) HSP 1 Score: 198 bits (504), Expect = 3.53e-64 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of MC02g_new0139 vs. ExPASy TrEMBL
Match: A0A1U7WSH0 (Histone H4 OS=Nicotiana sylvestris OX=4096 GN=LOC104226805 PE=3 SV=1) HSP 1 Score: 198 bits (504), Expect = 3.53e-64 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of MC02g_new0139 vs. ExPASy TrEMBL
Match: A0A1U8PD97 (Histone H4 OS=Gossypium hirsutum OX=3635 GN=LOC107957992 PE=3 SV=1) HSP 1 Score: 198 bits (504), Expect = 3.53e-64 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of MC02g_new0139 vs. TAIR 10
Match: AT1G07660.1 (Histone superfamily protein ) HSP 1 Score: 199.5 bits (506), Expect = 1.3e-51 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of MC02g_new0139 vs. TAIR 10
Match: AT1G07820.1 (Histone superfamily protein ) HSP 1 Score: 199.5 bits (506), Expect = 1.3e-51 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of MC02g_new0139 vs. TAIR 10
Match: AT1G07820.2 (Histone superfamily protein ) HSP 1 Score: 199.5 bits (506), Expect = 1.3e-51 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of MC02g_new0139 vs. TAIR 10
Match: AT2G28740.1 (histone H4 ) HSP 1 Score: 199.5 bits (506), Expect = 1.3e-51 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of MC02g_new0139 vs. TAIR 10
Match: AT3G45930.1 (Histone superfamily protein ) HSP 1 Score: 199.5 bits (506), Expect = 1.3e-51 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|