MC02g0973 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTTCCAGGAATGTTTATGCGCAAGCCCGACAAGGCTGCTGCTCTGAAGCAGCTTCGGTCGCACGTCGCTATGTTCGGCGTATGGGTTGCTGTAATTCGAGTTACCCCCTACGTTCTCCACTACCTTTCCGACGAGAAAGAAGAGCTCAAGCTCGAGTTT ATGTTTCCAGGAATGTTTATGCGCAAGCCCGACAAGGCTGCTGCTCTGAAGCAGCTTCGGTCGCACGTCGCTATGTTCGGCGTATGGGTTGCTGTAATTCGAGTTACCCCCTACGTTCTCCACTACCTTTCCGACGAGAAAGAAGAGCTCAAGCTCGAGTTT ATGTTTCCAGGAATGTTTATGCGCAAGCCCGACAAGGCTGCTGCTCTGAAGCAGCTTCGGTCGCACGTCGCTATGTTCGGCGTATGGGTTGCTGTAATTCGAGTTACCCCCTACGTTCTCCACTACCTTTCCGACGAGAAAGAAGAGCTCAAGCTCGAGTTT MFPGMFMRKPDKAAALKQLRSHVAMFGVWVAVIRVTPYVLHYLSDEKEELKLEF Homology
BLAST of MC02g0973 vs. ExPASy Swiss-Prot
Match: Q9XIA7 (Mitochondrial import receptor subunit TOM6 homolog OS=Arabidopsis thaliana OX=3702 GN=TOM6 PE=1 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 8.2e-18 Identity = 40/54 (74.07%), Postives = 46/54 (85.19%), Query Frame = 0
BLAST of MC02g0973 vs. NCBI nr
Match: XP_022148517.1 (mitochondrial import receptor subunit TOM6 homolog [Momordica charantia]) HSP 1 Score: 114 bits (284), Expect = 8.55e-32 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 0
BLAST of MC02g0973 vs. NCBI nr
Match: XP_004154290.1 (mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] >XP_008459248.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis melo] >XP_011649217.1 mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] >XP_022943932.1 mitochondrial import receptor subunit TOM6 homolog [Cucurbita moschata] >XP_022943933.1 mitochondrial import receptor subunit TOM6 homolog [Cucurbita moschata] >XP_022948071.1 mitochondrial import receptor subunit TOM6 homolog [Cucurbita moschata] >XP_022986654.1 mitochondrial import receptor subunit TOM6 homolog [Cucurbita maxima] >XP_022986655.1 mitochondrial import receptor subunit TOM6 homolog [Cucurbita maxima] >XP_022986656.1 mitochondrial import receptor subunit TOM6 homolog [Cucurbita maxima] >XP_023007537.1 mitochondrial import receptor subunit TOM6 homolog [Cucurbita maxima] >XP_023511843.1 mitochondrial import receptor subunit TOM6 homolog [Cucurbita pepo subsp. pepo] >XP_023511844.1 mitochondrial import receptor subunit TOM6 homolog [Cucurbita pepo subsp. pepo] >XP_023532551.1 mitochondrial import receptor subunit TOM6 homolog [Cucurbita pepo subsp. pepo] >XP_038900853.1 mitochondrial import receptor subunit TOM6 homolog [Benincasa hispida] >KAA0045963.1 Mitochondrial import receptor subunit TOM6 -like protein [Cucumis melo var. makuwa] >KGN61761.1 hypothetical protein Csa_006573 [Cucumis sativus] >TYK13622.1 Mitochondrial import receptor subunit TOM6 -like protein [Cucumis melo var. makuwa]) HSP 1 Score: 112 bits (281), Expect = 2.45e-31 Identity = 53/54 (98.15%), Postives = 54/54 (100.00%), Query Frame = 0
BLAST of MC02g0973 vs. NCBI nr
Match: MBA0872591.1 (hypothetical protein [Gossypium schwendimanii]) HSP 1 Score: 110 bits (274), Expect = 2.88e-30 Identity = 49/54 (90.74%), Postives = 54/54 (100.00%), Query Frame = 0
BLAST of MC02g0973 vs. NCBI nr
Match: XP_038992352.1 (mitochondrial import receptor subunit TOM6 homolog [Hibiscus syriacus]) HSP 1 Score: 110 bits (274), Expect = 2.88e-30 Identity = 50/54 (92.59%), Postives = 54/54 (100.00%), Query Frame = 0
BLAST of MC02g0973 vs. NCBI nr
Match: XP_012458101.1 (PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium raimondii] >XP_016731270.1 mitochondrial import receptor subunit TOM6 homolog [Gossypium hirsutum] >XP_017613195.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium arboreum] >KAB2036108.1 hypothetical protein ES319_D04G200500v1 [Gossypium barbadense] >MBA0572665.1 hypothetical protein [Gossypium lobatum] >MBA0782181.1 hypothetical protein [Gossypium trilobum] >TYG74796.1 hypothetical protein ES288_D04G211400v1 [Gossypium darwinii] >TYH78247.1 hypothetical protein ES332_D04G212500v1 [Gossypium tomentosum] >TYJ40795.1 hypothetical protein E1A91_A04G165400v1 [Gossypium mustelinum]) HSP 1 Score: 110 bits (274), Expect = 2.88e-30 Identity = 49/54 (90.74%), Postives = 54/54 (100.00%), Query Frame = 0
BLAST of MC02g0973 vs. ExPASy TrEMBL
Match: A0A6J1D5A0 (mitochondrial import receptor subunit TOM6 homolog OS=Momordica charantia OX=3673 GN=LOC111017146 PE=4 SV=1) HSP 1 Score: 114 bits (284), Expect = 4.14e-32 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 0
BLAST of MC02g0973 vs. ExPASy TrEMBL
Match: A0A6J1JEM5 (mitochondrial import receptor subunit TOM6 homolog OS=Cucurbita maxima OX=3661 GN=LOC111484330 PE=4 SV=1) HSP 1 Score: 112 bits (281), Expect = 1.19e-31 Identity = 53/54 (98.15%), Postives = 54/54 (100.00%), Query Frame = 0
BLAST of MC02g0973 vs. ExPASy TrEMBL
Match: A0A6J1FXI3 (mitochondrial import receptor subunit TOM6 homolog OS=Cucurbita moschata OX=3662 GN=LOC111448504 PE=4 SV=1) HSP 1 Score: 112 bits (281), Expect = 1.19e-31 Identity = 53/54 (98.15%), Postives = 54/54 (100.00%), Query Frame = 0
BLAST of MC02g0973 vs. ExPASy TrEMBL
Match: A0A5A7TQX5 (Mitochondrial import receptor subunit TOM6-like protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold299G001260 PE=4 SV=1) HSP 1 Score: 112 bits (281), Expect = 1.19e-31 Identity = 53/54 (98.15%), Postives = 54/54 (100.00%), Query Frame = 0
BLAST of MC02g0973 vs. ExPASy TrEMBL
Match: A0A0A0LP29 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G238770 PE=4 SV=1) HSP 1 Score: 112 bits (281), Expect = 1.19e-31 Identity = 53/54 (98.15%), Postives = 54/54 (100.00%), Query Frame = 0
BLAST of MC02g0973 vs. TAIR 10
Match: AT1G49410.1 (translocase of the outer mitochondrial membrane 6 ) HSP 1 Score: 90.1 bits (222), Expect = 5.8e-19 Identity = 40/54 (74.07%), Postives = 46/54 (85.19%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|