
MC02g0299 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCCAGAGGCACCTCTCAATCTCAATCTGCATCCTCTTCGACATCCAGACCTGGCGTCGCGGCTCCGCGTGGCTCCGCGGCGGCGACCGCCGGCCTCCGTCGACGTCGTCTCACATCCACTGGTTCCGCCGGCTCTGGTGGAGTTGTTGGCGCCGGATCGAGTGGCGGTGGCAACATGTTGAGGTTCTACACCGACGATGCTCCTGGCTTGAAGATTTCCCCCACCGTCGTCCTCGTCATGAGCCTCTGTTTCATCGGATTCGTTACCGGCCTCCACGTCTTTGGTAAGCTCTATCGAGCGCGATCCGGCGCGGGAGTT ATGGCCAGAGGCACCTCTCAATCTCAATCTGCATCCTCTTCGACATCCAGACCTGGCGTCGCGGCTCCGCGTGGCTCCGCGGCGGCGACCGCCGGCCTCCGTCGACGTCGTCTCACATCCACTGGTTCCGCCGGCTCTGGTGGAGTTGTTGGCGCCGGATCGAGTGGCGGTGGCAACATGTTGAGGTTCTACACCGACGATGCTCCTGGCTTGAAGATTTCCCCCACCGTCGTCCTCGTCATGAGCCTCTGTTTCATCGGATTCGTTACCGGCCTCCACGTCTTTGGTAAGCTCTATCGAGCGCGATCCGGCGCGGGAGTT ATGGCCAGAGGCACCTCTCAATCTCAATCTGCATCCTCTTCGACATCCAGACCTGGCGTCGCGGCTCCGCGTGGCTCCGCGGCGGCGACCGCCGGCCTCCGTCGACGTCGTCTCACATCCACTGGTTCCGCCGGCTCTGGTGGAGTTGTTGGCGCCGGATCGAGTGGCGGTGGCAACATGTTGAGGTTCTACACCGACGATGCTCCTGGCTTGAAGATTTCCCCCACCGTCGTCCTCGTCATGAGCCTCTGTTTCATCGGATTCGTTACCGGCCTCCACGTCTTTGGTAAGCTCTATCGAGCGCGATCCGGCGCGGGAGTT MARGTSQSQSASSSTSRPGVAAPRGSAAATAGLRRRRLTSTGSAGSGGVVGAGSSGGGNMLRFYTDDAPGLKISPTVVLVMSLCFIGFVTGLHVFGKLYRARSGAGV Homology
BLAST of MC02g0299 vs. ExPASy Swiss-Prot
Match: P38389 (Protein transport protein Sec61 subunit beta OS=Arabidopsis thaliana OX=3702 GN=At2g45070 PE=1 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 1.8e-16 Identity = 54/84 (64.29%), Postives = 61/84 (72.62%), Query Frame = 0
BLAST of MC02g0299 vs. ExPASy Swiss-Prot
Match: P60467 (Protein transport protein Sec61 subunit beta OS=Canis lupus familiaris OX=9615 GN=SEC61B PE=1 SV=2) HSP 1 Score: 56.2 bits (134), Expect = 2.6e-07 Identity = 40/97 (41.24%), Postives = 55/97 (56.70%), Query Frame = 0
BLAST of MC02g0299 vs. ExPASy Swiss-Prot
Match: P60468 (Protein transport protein Sec61 subunit beta OS=Homo sapiens OX=9606 GN=SEC61B PE=1 SV=2) HSP 1 Score: 56.2 bits (134), Expect = 2.6e-07 Identity = 40/97 (41.24%), Postives = 55/97 (56.70%), Query Frame = 0
BLAST of MC02g0299 vs. ExPASy Swiss-Prot
Match: Q9CQS8 (Protein transport protein Sec61 subunit beta OS=Mus musculus OX=10090 GN=Sec61b PE=1 SV=3) HSP 1 Score: 56.2 bits (134), Expect = 2.6e-07 Identity = 40/97 (41.24%), Postives = 55/97 (56.70%), Query Frame = 0
BLAST of MC02g0299 vs. ExPASy Swiss-Prot
Match: Q5RB31 (Protein transport protein Sec61 subunit beta OS=Pongo abelii OX=9601 GN=SEC61B PE=3 SV=3) HSP 1 Score: 56.2 bits (134), Expect = 2.6e-07 Identity = 40/97 (41.24%), Postives = 55/97 (56.70%), Query Frame = 0
BLAST of MC02g0299 vs. NCBI nr
Match: XP_022140347.1 (protein transport protein Sec61 subunit beta [Momordica charantia]) HSP 1 Score: 198 bits (504), Expect = 9.78e-64 Identity = 107/107 (100.00%), Postives = 107/107 (100.00%), Query Frame = 0
BLAST of MC02g0299 vs. NCBI nr
Match: XP_022958107.1 (protein transport protein Sec61 subunit beta [Cucurbita moschata] >XP_022995532.1 protein transport protein Sec61 subunit beta [Cucurbita maxima] >XP_023534505.1 protein transport protein Sec61 subunit beta [Cucurbita pepo subsp. pepo] >KAG7013903.1 Protein transport protein Sec61 subunit beta, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 177 bits (449), Expect = 2.39e-55 Identity = 96/107 (89.72%), Postives = 99/107 (92.52%), Query Frame = 0
BLAST of MC02g0299 vs. NCBI nr
Match: XP_038902812.1 (protein transport protein Sec61 subunit beta [Benincasa hispida]) HSP 1 Score: 174 bits (441), Expect = 3.97e-54 Identity = 95/107 (88.79%), Postives = 97/107 (90.65%), Query Frame = 0
BLAST of MC02g0299 vs. NCBI nr
Match: XP_004149541.1 (protein transport protein Sec61 subunit beta [Cucumis sativus] >KGN47316.1 hypothetical protein Csa_023023 [Cucumis sativus]) HSP 1 Score: 166 bits (420), Expect = 6.73e-51 Identity = 92/109 (84.40%), Postives = 98/109 (89.91%), Query Frame = 0
BLAST of MC02g0299 vs. NCBI nr
Match: XP_008463929.1 (PREDICTED: protein transport protein Sec61 subunit beta [Cucumis melo] >KAA0035333.1 protein transport protein Sec61 subunit beta [Cucumis melo var. makuwa] >TYK14304.1 protein transport protein Sec61 subunit beta [Cucumis melo var. makuwa]) HSP 1 Score: 166 bits (419), Expect = 9.55e-51 Identity = 92/109 (84.40%), Postives = 97/109 (88.99%), Query Frame = 0
BLAST of MC02g0299 vs. ExPASy TrEMBL
Match: A0A6J1CGL0 (Protein transport protein Sec61 subunit beta OS=Momordica charantia OX=3673 GN=LOC111011042 PE=3 SV=1) HSP 1 Score: 198 bits (504), Expect = 4.73e-64 Identity = 107/107 (100.00%), Postives = 107/107 (100.00%), Query Frame = 0
BLAST of MC02g0299 vs. ExPASy TrEMBL
Match: A0A6J1JZ65 (Protein transport protein Sec61 subunit beta OS=Cucurbita maxima OX=3661 GN=LOC111491039 PE=3 SV=1) HSP 1 Score: 177 bits (449), Expect = 1.16e-55 Identity = 96/107 (89.72%), Postives = 99/107 (92.52%), Query Frame = 0
BLAST of MC02g0299 vs. ExPASy TrEMBL
Match: A0A6J1H102 (Protein transport protein Sec61 subunit beta OS=Cucurbita moschata OX=3662 GN=LOC111459432 PE=3 SV=1) HSP 1 Score: 177 bits (449), Expect = 1.16e-55 Identity = 96/107 (89.72%), Postives = 99/107 (92.52%), Query Frame = 0
BLAST of MC02g0299 vs. ExPASy TrEMBL
Match: A0A0A0KHR1 (Protein transport protein Sec61 subunit beta OS=Cucumis sativus OX=3659 GN=Csa_6G293930 PE=3 SV=1) HSP 1 Score: 166 bits (420), Expect = 3.26e-51 Identity = 92/109 (84.40%), Postives = 98/109 (89.91%), Query Frame = 0
BLAST of MC02g0299 vs. ExPASy TrEMBL
Match: A0A5D3CTD4 (Protein transport protein Sec61 subunit beta OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold84G00270 PE=3 SV=1) HSP 1 Score: 166 bits (419), Expect = 4.63e-51 Identity = 92/109 (84.40%), Postives = 97/109 (88.99%), Query Frame = 0
BLAST of MC02g0299 vs. TAIR 10
Match: AT5G60460.1 (Preprotein translocase Sec, Sec61-beta subunit protein ) HSP 1 Score: 138.7 bits (348), Expect = 2.8e-33 Identity = 81/108 (75.00%), Postives = 88/108 (81.48%), Query Frame = 0
BLAST of MC02g0299 vs. TAIR 10
Match: AT2G45070.1 (Preprotein translocase Sec, Sec61-beta subunit protein ) HSP 1 Score: 86.7 bits (213), Expect = 1.3e-17 Identity = 54/84 (64.29%), Postives = 61/84 (72.62%), Query Frame = 0
BLAST of MC02g0299 vs. TAIR 10
Match: AT2G45070.2 (Preprotein translocase Sec, Sec61-beta subunit protein ) HSP 1 Score: 86.7 bits (213), Expect = 1.3e-17 Identity = 54/84 (64.29%), Postives = 61/84 (72.62%), Query Frame = 0
BLAST of MC02g0299 vs. TAIR 10
Match: AT2G45070.3 (Preprotein translocase Sec, Sec61-beta subunit protein ) HSP 1 Score: 86.7 bits (213), Expect = 1.3e-17 Identity = 54/84 (64.29%), Postives = 61/84 (72.62%), Query Frame = 0
BLAST of MC02g0299 vs. TAIR 10
Match: AT2G45070.4 (Preprotein translocase Sec, Sec61-beta subunit protein ) HSP 1 Score: 86.7 bits (213), Expect = 1.3e-17 Identity = 54/84 (64.29%), Postives = 61/84 (72.62%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|