
MC02g0188 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGAAGAAAGTAGCGGCGGAGATCGAAGAGCTTCCCAAGACCATTGTTCGCCGAGTGGTTAAAGAGAAGCTTTCTCAGTGCTCCCGGAACCAAGACATTTCCGTCAACAAAGACTCGCTTCTTGCCTTCTGCGAGAGCGCTCGAATCTTCATTCACTACCTCTCCGCTACGTAAGCTCGGCAACCTGCCCTAATGCTTTCAATTCTGAATGAAATTCTATTGATTCTGATGGTAGAAACTAGGGTTCCTTGTTTCTCTGCTGTTTACCTAAAATACGAACGCGAAACCGATTAGAGCCATGTATTTCTGGTTGTTATGGCGCTAGGGTTAACGAAATTGAAGTTTTGTACTGGTTAGTTCTTGTATTCGTACTAACTCGTAGATCTCTAAGCAGGTCGAATGATATATGCAAGGAATCGAAGAGGCAGACGATAAAGGCGGATGATGTATTGAAAGCTCTAGAAGATATGGAATTTCCCGAGTTGGTTAGGCCTCTCAAAGCCTCCCTCAAT ATGGAGAAGAAAGTAGCGGCGGAGATCGAAGAGCTTCCCAAGACCATTGTTCGCCGAGTGGTTAAAGAGAAGCTTTCTCAGTGCTCCCGGAACCAAGACATTTCCGTCAACAAAGACTCGCTTCTTGCCTTCTGCGAGAGCGCTCGAATCTTCATTCACTACCTCTCCGCTACGTCGAATGATATATGCAAGGAATCGAAGAGGCAGACGATAAAGGCGGATGATGTATTGAAAGCTCTAGAAGATATGGAATTTCCCGAGTTGGTTAGGCCTCTCAAAGCCTCCCTCAAT ATGGAGAAGAAAGTAGCGGCGGAGATCGAAGAGCTTCCCAAGACCATTGTTCGCCGAGTGGTTAAAGAGAAGCTTTCTCAGTGCTCCCGGAACCAAGACATTTCCGTCAACAAAGACTCGCTTCTTGCCTTCTGCGAGAGCGCTCGAATCTTCATTCACTACCTCTCCGCTACGTCGAATGATATATGCAAGGAATCGAAGAGGCAGACGATAAAGGCGGATGATGTATTGAAAGCTCTAGAAGATATGGAATTTCCCGAGTTGGTTAGGCCTCTCAAAGCCTCCCTCAAT MEKKVAAEIEELPKTIVRRVVKEKLSQCSRNQDISVNKDSLLAFCESARIFIHYLSATSNDICKESKRQTIKADDVLKALEDMEFPELVRPLKASLN Homology
BLAST of MC02g0188 vs. ExPASy Swiss-Prot
Match: Q3SZN5 (DNA polymerase epsilon subunit 3 OS=Bos taurus OX=9913 GN=POLE3 PE=2 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 7.3e-09 Identity = 29/85 (34.12%), Postives = 52/85 (61.18%), Query Frame = 0
BLAST of MC02g0188 vs. ExPASy Swiss-Prot
Match: Q9NRF9 (DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 7.3e-09 Identity = 29/85 (34.12%), Postives = 52/85 (61.18%), Query Frame = 0
BLAST of MC02g0188 vs. ExPASy Swiss-Prot
Match: Q5R4W3 (DNA polymerase epsilon subunit 3 OS=Pongo abelii OX=9601 GN=POLE3 PE=2 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 7.3e-09 Identity = 29/85 (34.12%), Postives = 52/85 (61.18%), Query Frame = 0
BLAST of MC02g0188 vs. ExPASy Swiss-Prot
Match: Q642A5 (DNA polymerase epsilon subunit 3 OS=Rattus norvegicus OX=10116 GN=Pole3 PE=1 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 7.3e-09 Identity = 29/85 (34.12%), Postives = 52/85 (61.18%), Query Frame = 0
BLAST of MC02g0188 vs. ExPASy Swiss-Prot
Match: Q9JKP7 (DNA polymerase epsilon subunit 3 OS=Mus musculus OX=10090 GN=Pole3 PE=1 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 9.5e-09 Identity = 28/85 (32.94%), Postives = 52/85 (61.18%), Query Frame = 0
BLAST of MC02g0188 vs. NCBI nr
Match: XP_022152961.1 (DNA polymerase epsilon subunit 3 [Momordica charantia]) HSP 1 Score: 186 bits (471), Expect = 4.35e-58 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 0
BLAST of MC02g0188 vs. NCBI nr
Match: KAG7035929.1 (DNA polymerase epsilon subunit 3 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 182 bits (463), Expect = 7.42e-57 Identity = 95/97 (97.94%), Postives = 96/97 (98.97%), Query Frame = 0
BLAST of MC02g0188 vs. NCBI nr
Match: XP_023533668.1 (DNA polymerase epsilon subunit 3 [Cucurbita pepo subsp. pepo] >XP_023533669.1 DNA polymerase epsilon subunit 3 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 182 bits (463), Expect = 7.42e-57 Identity = 95/97 (97.94%), Postives = 96/97 (98.97%), Query Frame = 0
BLAST of MC02g0188 vs. NCBI nr
Match: XP_022958709.1 (DNA polymerase epsilon subunit 3 [Cucurbita moschata] >XP_022958710.1 DNA polymerase epsilon subunit 3 [Cucurbita moschata]) HSP 1 Score: 182 bits (463), Expect = 7.42e-57 Identity = 95/97 (97.94%), Postives = 96/97 (98.97%), Query Frame = 0
BLAST of MC02g0188 vs. NCBI nr
Match: KAG6605978.1 (DNA polymerase epsilon subunit 3, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 182 bits (463), Expect = 9.57e-57 Identity = 95/97 (97.94%), Postives = 96/97 (98.97%), Query Frame = 0
BLAST of MC02g0188 vs. ExPASy TrEMBL
Match: A0A6J1DJA4 (DNA polymerase epsilon subunit 3 OS=Momordica charantia OX=3673 GN=LOC111020575 PE=4 SV=1) HSP 1 Score: 186 bits (471), Expect = 2.11e-58 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 0
BLAST of MC02g0188 vs. ExPASy TrEMBL
Match: A0A6J1H495 (DNA polymerase epsilon subunit 3 OS=Cucurbita moschata OX=3662 GN=LOC111459853 PE=4 SV=1) HSP 1 Score: 182 bits (463), Expect = 3.59e-57 Identity = 95/97 (97.94%), Postives = 96/97 (98.97%), Query Frame = 0
BLAST of MC02g0188 vs. ExPASy TrEMBL
Match: A0A6J1K184 (DNA polymerase epsilon subunit 3 OS=Cucurbita maxima OX=3661 GN=LOC111490783 PE=4 SV=1) HSP 1 Score: 182 bits (462), Expect = 6.37e-57 Identity = 94/97 (96.91%), Postives = 96/97 (98.97%), Query Frame = 0
BLAST of MC02g0188 vs. ExPASy TrEMBL
Match: A0A1S3BNA4 (DNA polymerase epsilon subunit D OS=Cucumis melo OX=3656 GN=LOC103491421 PE=4 SV=1) HSP 1 Score: 176 bits (447), Expect = 7.14e-55 Identity = 91/97 (93.81%), Postives = 95/97 (97.94%), Query Frame = 0
BLAST of MC02g0188 vs. ExPASy TrEMBL
Match: A0A5A7V2B9 (DNA polymerase epsilon subunit D isoform X1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold182G00130 PE=4 SV=1) HSP 1 Score: 171 bits (432), Expect = 2.65e-53 Identity = 91/101 (90.10%), Postives = 95/101 (94.06%), Query Frame = 0
BLAST of MC02g0188 vs. TAIR 10
Match: AT2G27470.1 (nuclear factor Y, subunit B11 ) HSP 1 Score: 125.2 bits (313), Expect = 2.9e-29 Identity = 59/88 (67.05%), Postives = 78/88 (88.64%), Query Frame = 0
BLAST of MC02g0188 vs. TAIR 10
Match: AT5G23090.2 (nuclear factor Y, subunit B13 ) HSP 1 Score: 47.0 bits (110), Expect = 1.0e-05 Identity = 28/88 (31.82%), Postives = 48/88 (54.55%), Query Frame = 0
BLAST of MC02g0188 vs. TAIR 10
Match: AT5G23090.1 (nuclear factor Y, subunit B13 ) HSP 1 Score: 47.0 bits (110), Expect = 1.0e-05 Identity = 28/88 (31.82%), Postives = 48/88 (54.55%), Query Frame = 0
BLAST of MC02g0188 vs. TAIR 10
Match: AT5G23090.4 (nuclear factor Y, subunit B13 ) HSP 1 Score: 47.0 bits (110), Expect = 1.0e-05 Identity = 28/88 (31.82%), Postives = 48/88 (54.55%), Query Frame = 0
BLAST of MC02g0188 vs. TAIR 10
Match: AT5G08190.1 (nuclear factor Y, subunit B12 ) HSP 1 Score: 46.2 bits (108), Expect = 1.7e-05 Identity = 28/88 (31.82%), Postives = 48/88 (54.55%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|