![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MC01g1679 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.CACAGGAACATCATGAGATTGCTTGCATTATGCTCGAATAAGCAGACGAATCTGCTGGTTTACGAGTACATGCCCAATGGAAGTTTAGGAGAAGTGCTACATGGGAAGAGAGGTGGTTGTCTAAAATGGGGAACCAGGCTGAAGATAGCTATAGAAGCCGCCAAAGGGTTTGCTATTTGCACCATGACTGTTTGCACCTCATAATTCACAGGGACGTCAACAAGTCCAACAACATTTTGCTCAAC CACAGGAACATCATGAGATTGCTTGCATTATGCTCGAATAAGCAGACGAATCTGCTGGTTTACGAGTACATGCCCAATGGAAGTTTAGGAGAAGTGCTACATGGGAAGAGAGGTGGTTGTCTAAAATGGGGAACCAGGCTGAAGATAGCTATAGAAGCCGCCAAAGGGTGCTATTTGCACCATGACTGTTTGCACCTCATAATTCACAGGGACGTCAACAAGTCCAACAACATTTTGCTCAAC CACAGGAACATCATGAGATTGCTTGCATTATGCTCGAATAAGCAGACGAATCTGCTGGTTTACGAGTACATGCCCAATGGAAGTTTAGGAGAAGTGCTACATGGGAAGAGAGGTGGTTGTCTAAAATGGGGAACCAGGCTGAAGATAGCTATAGAAGCCGCCAAAGGGTGCTATTTGCACCATGACTGTTTGCACCTCATAATTCACAGGGACGTCAACAAGTCCAACAACATTTTGCTCAAC HRNIMRLLALCSNKQTNLLVYEYMPNGSLGEVLHGKRGGCLKWGTRLKIAIEAAKGCYLHHDCLHLIIHRDVNKSNNILLN Homology
BLAST of MC01g1679 vs. ExPASy Swiss-Prot
Match: O65440 (Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3 OS=Arabidopsis thaliana OX=3702 GN=BAM3 PE=1 SV=3) HSP 1 Score: 132.5 bits (332), Expect = 2.2e-30 Identity = 67/81 (82.72%), Postives = 70/81 (86.42%), Query Frame = 0
BLAST of MC01g1679 vs. ExPASy Swiss-Prot
Match: Q9M2Z1 (Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 OS=Arabidopsis thaliana OX=3702 GN=BAM2 PE=1 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 4.8e-30 Identity = 64/82 (78.05%), Postives = 71/82 (86.59%), Query Frame = 0
BLAST of MC01g1679 vs. ExPASy Swiss-Prot
Match: O49545 (Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1 OS=Arabidopsis thaliana OX=3702 GN=BAM1 PE=1 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 6.3e-30 Identity = 64/82 (78.05%), Postives = 71/82 (86.59%), Query Frame = 0
BLAST of MC01g1679 vs. ExPASy Swiss-Prot
Match: A0A0R0HPY5 (Leucine-rich repeat receptor-like kinase protein CLV1a OS=Glycine max OX=3847 GN=CLV1A PE=2 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 1.2e-28 Identity = 64/82 (78.05%), Postives = 69/82 (84.15%), Query Frame = 0
BLAST of MC01g1679 vs. ExPASy Swiss-Prot
Match: Q9M6A7 (Leucine-rich repeat receptor-like kinase protein CLV1B OS=Glycine max OX=3847 GN=CLV1B PE=2 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 1.2e-28 Identity = 64/82 (78.05%), Postives = 69/82 (84.15%), Query Frame = 0
BLAST of MC01g1679 vs. NCBI nr
Match: KAG6594367.1 (Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 151 bits (382), Expect = 2.21e-40 Identity = 75/82 (91.46%), Postives = 76/82 (92.68%), Query Frame = 0
BLAST of MC01g1679 vs. NCBI nr
Match: XP_022926540.1 (leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3 [Cucurbita moschata]) HSP 1 Score: 151 bits (382), Expect = 2.23e-40 Identity = 75/82 (91.46%), Postives = 76/82 (92.68%), Query Frame = 0
BLAST of MC01g1679 vs. NCBI nr
Match: KAG7026373.1 (Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 151 bits (382), Expect = 2.23e-40 Identity = 75/82 (91.46%), Postives = 76/82 (92.68%), Query Frame = 0
BLAST of MC01g1679 vs. NCBI nr
Match: XP_023517788.1 (leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 151 bits (382), Expect = 2.23e-40 Identity = 75/82 (91.46%), Postives = 76/82 (92.68%), Query Frame = 0
BLAST of MC01g1679 vs. NCBI nr
Match: XP_023003629.1 (leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3 [Cucurbita maxima]) HSP 1 Score: 151 bits (382), Expect = 2.23e-40 Identity = 75/82 (91.46%), Postives = 76/82 (92.68%), Query Frame = 0
BLAST of MC01g1679 vs. ExPASy TrEMBL
Match: A0A6J1KTV5 (leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3 OS=Cucurbita maxima OX=3661 GN=LOC111497170 PE=3 SV=1) HSP 1 Score: 151 bits (382), Expect = 1.08e-40 Identity = 75/82 (91.46%), Postives = 76/82 (92.68%), Query Frame = 0
BLAST of MC01g1679 vs. ExPASy TrEMBL
Match: A0A6J1ELE5 (leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3 OS=Cucurbita moschata OX=3662 GN=LOC111433655 PE=3 SV=1) HSP 1 Score: 151 bits (382), Expect = 1.08e-40 Identity = 75/82 (91.46%), Postives = 76/82 (92.68%), Query Frame = 0
BLAST of MC01g1679 vs. ExPASy TrEMBL
Match: A0A1Q3BTJ5 (LRR_1 domain-containing protein/Pkinase_Tyr domain-containing protein/LRR_6 domain-containing protein (Fragment) OS=Cephalotus follicularis OX=3775 GN=CFOL_v3_14779 PE=4 SV=1) HSP 1 Score: 146 bits (368), Expect = 7.38e-39 Identity = 73/82 (89.02%), Postives = 75/82 (91.46%), Query Frame = 0
BLAST of MC01g1679 vs. ExPASy TrEMBL
Match: A0A2N9F656 (Protein kinase domain-containing protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS10525 PE=3 SV=1) HSP 1 Score: 145 bits (367), Expect = 1.15e-38 Identity = 72/82 (87.80%), Postives = 75/82 (91.46%), Query Frame = 0
BLAST of MC01g1679 vs. ExPASy TrEMBL
Match: F6HGD8 (Protein kinase domain-containing protein OS=Vitis vinifera OX=29760 GN=VIT_01s0010g00330 PE=3 SV=1) HSP 1 Score: 145 bits (366), Expect = 1.57e-38 Identity = 72/82 (87.80%), Postives = 75/82 (91.46%), Query Frame = 0
BLAST of MC01g1679 vs. TAIR 10
Match: AT4G20270.1 (Leucine-rich receptor-like protein kinase family protein ) HSP 1 Score: 132.5 bits (332), Expect = 1.5e-31 Identity = 67/81 (82.72%), Postives = 70/81 (86.42%), Query Frame = 0
BLAST of MC01g1679 vs. TAIR 10
Match: AT3G49670.1 (Leucine-rich receptor-like protein kinase family protein ) HSP 1 Score: 131.3 bits (329), Expect = 3.4e-31 Identity = 64/82 (78.05%), Postives = 71/82 (86.59%), Query Frame = 0
BLAST of MC01g1679 vs. TAIR 10
Match: AT5G65700.1 (Leucine-rich receptor-like protein kinase family protein ) HSP 1 Score: 131.0 bits (328), Expect = 4.4e-31 Identity = 64/82 (78.05%), Postives = 71/82 (86.59%), Query Frame = 0
BLAST of MC01g1679 vs. TAIR 10
Match: AT5G65700.2 (Leucine-rich receptor-like protein kinase family protein ) HSP 1 Score: 131.0 bits (328), Expect = 4.4e-31 Identity = 64/82 (78.05%), Postives = 71/82 (86.59%), Query Frame = 0
BLAST of MC01g1679 vs. TAIR 10
Match: AT1G75820.1 (Leucine-rich receptor-like protein kinase family protein ) HSP 1 Score: 120.9 bits (302), Expect = 4.6e-28 Identity = 58/82 (70.73%), Postives = 70/82 (85.37%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|