![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MC01g1661 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.CTTTCCGCCACCTCCATTAAAGAGAATATTCTTTTTGGGAAGGAGGATGCTGTCATGGACGAGGTAGTGGAGGCGGCTAAAGCTTTCAATGCTCATAATTTTACTGCTCAGTTTTCAAGAGGATACGAAACCCATGTA CTTTCCGCCACCTCCATTAAAGAGAATATTCTTTTTGGGAAGGAGGATGCTGTCATGGACGAGGTAGTGGAGGCGGCTAAAGCTTTCAATGCTCATAATTTTACTGCTCAGTTTTCAAGAGGATACGAAACCCATGTA CTTTCCGCCACCTCCATTAAAGAGAATATTCTTTTTGGGAAGGAGGATGCTGTCATGGACGAGGTAGTGGAGGCGGCTAAAGCTTTCAATGCTCATAATTTTACTGCTCAGTTTTCAAGAGGATACGAAACCCATGTA LSATSIKENILFGKEDAVMDEVVEAAKAFNAHNFTAQFSRGYETHV Homology
BLAST of MC01g1661 vs. ExPASy Swiss-Prot
Match: Q9LSJ8 (ABC transporter B family member 16 OS=Arabidopsis thaliana OX=3702 GN=ABCB16 PE=2 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 2.0e-12 Identity = 36/46 (78.26%), Postives = 38/46 (82.61%), Query Frame = 0
BLAST of MC01g1661 vs. ExPASy Swiss-Prot
Match: Q9LHD1 (ABC transporter B family member 15 OS=Arabidopsis thaliana OX=3702 GN=ABCB15 PE=3 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 5.7e-12 Identity = 35/46 (76.09%), Postives = 38/46 (82.61%), Query Frame = 0
BLAST of MC01g1661 vs. ExPASy Swiss-Prot
Match: Q9LSJ5 (ABC transporter B family member 18 OS=Arabidopsis thaliana OX=3702 GN=ABCB18 PE=3 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 9.7e-12 Identity = 35/46 (76.09%), Postives = 38/46 (82.61%), Query Frame = 0
BLAST of MC01g1661 vs. ExPASy Swiss-Prot
Match: Q9LSJ6 (ABC transporter B family member 17 OS=Arabidopsis thaliana OX=3702 GN=ABCB17 PE=3 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 6.3e-11 Identity = 34/46 (73.91%), Postives = 37/46 (80.43%), Query Frame = 0
BLAST of MC01g1661 vs. ExPASy Swiss-Prot
Match: Q9LSJ2 (ABC transporter B family member 22 OS=Arabidopsis thaliana OX=3702 GN=ABCB22 PE=3 SV=2) HSP 1 Score: 66.2 bits (160), Expect = 1.1e-10 Identity = 33/46 (71.74%), Postives = 38/46 (82.61%), Query Frame = 0
BLAST of MC01g1661 vs. NCBI nr
Match: XP_022990825.1 (ABC transporter B family member 15-like [Cucurbita maxima]) HSP 1 Score: 75.5 bits (184), Expect = 2.83e-14 Identity = 37/46 (80.43%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MC01g1661 vs. NCBI nr
Match: XP_022964967.1 (ABC transporter B family member 15-like [Cucurbita moschata]) HSP 1 Score: 75.5 bits (184), Expect = 2.83e-14 Identity = 37/46 (80.43%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MC01g1661 vs. NCBI nr
Match: XP_023517420.1 (ABC transporter B family member 15-like isoform X1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 75.5 bits (184), Expect = 2.83e-14 Identity = 37/46 (80.43%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MC01g1661 vs. NCBI nr
Match: KAG6602466.1 (ABC transporter B family member 15, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 75.5 bits (184), Expect = 2.83e-14 Identity = 37/46 (80.43%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MC01g1661 vs. NCBI nr
Match: XP_023517428.1 (ABC transporter B family member 15-like isoform X2 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 75.5 bits (184), Expect = 2.83e-14 Identity = 37/46 (80.43%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MC01g1661 vs. ExPASy TrEMBL
Match: A0A6J1JR61 (ABC transporter B family member 15-like OS=Cucurbita maxima OX=3661 GN=LOC111487603 PE=4 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 1.37e-14 Identity = 37/46 (80.43%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MC01g1661 vs. ExPASy TrEMBL
Match: A0A6J1HJ31 (ABC transporter B family member 15-like OS=Cucurbita moschata OX=3662 GN=LOC111464915 PE=4 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 1.37e-14 Identity = 37/46 (80.43%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MC01g1661 vs. ExPASy TrEMBL
Match: A0A6J1BVL9 (LOW QUALITY PROTEIN: ABC transporter B family member 15-like OS=Momordica charantia OX=3673 GN=LOC111006155 PE=4 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 1.87e-14 Identity = 36/46 (78.26%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MC01g1661 vs. ExPASy TrEMBL
Match: A0A1J3EYF6 (ABC transporter B family member 17 (Fragment) OS=Noccaea caerulescens OX=107243 GN=LC_TR7397_c19_g1_i1_g.25607 PE=4 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 2.16e-14 Identity = 34/46 (73.91%), Postives = 39/46 (84.78%), Query Frame = 0
BLAST of MC01g1661 vs. ExPASy TrEMBL
Match: A0A6J1BWU3 (ABC transporter B family member 15-like OS=Momordica charantia OX=3673 GN=LOC111006245 PE=4 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 3.49e-14 Identity = 36/46 (78.26%), Postives = 39/46 (84.78%), Query Frame = 0
BLAST of MC01g1661 vs. TAIR 10
Match: AT3G28360.1 (P-glycoprotein 16 ) HSP 1 Score: 72.0 bits (175), Expect = 1.4e-13 Identity = 36/46 (78.26%), Postives = 38/46 (82.61%), Query Frame = 0
BLAST of MC01g1661 vs. TAIR 10
Match: AT3G28345.1 (ABC transporter family protein ) HSP 1 Score: 70.5 bits (171), Expect = 4.1e-13 Identity = 35/46 (76.09%), Postives = 38/46 (82.61%), Query Frame = 0
BLAST of MC01g1661 vs. TAIR 10
Match: AT3G28390.1 (P-glycoprotein 18 ) HSP 1 Score: 69.7 bits (169), Expect = 6.9e-13 Identity = 35/46 (76.09%), Postives = 38/46 (82.61%), Query Frame = 0
BLAST of MC01g1661 vs. TAIR 10
Match: AT3G28380.1 (P-glycoprotein 17 ) HSP 1 Score: 67.0 bits (162), Expect = 4.5e-12 Identity = 34/46 (73.91%), Postives = 37/46 (80.43%), Query Frame = 0
BLAST of MC01g1661 vs. TAIR 10
Match: AT3G28415.1 (ABC transporter family protein ) HSP 1 Score: 66.2 bits (160), Expect = 7.6e-12 Identity = 33/46 (71.74%), Postives = 38/46 (82.61%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|