![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MC01g1587 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TGGTCATCCGTCGGTACTTGTGGATTTAAAGGTACGAGAAGAGGGACATCATTTGCTGCTCAAATCGCAACAAGAAACGCTATTCGAGTTGTAGTGAGTCAGGGTATACTACAAGCAGAAGTCATGGTAAAA TGGTCATCCGTCGGTACTTGTGGATTTAAAGGTACGAGAAGAGGGACATCATTTGCTGCTCAAATCGCAACAAGAAACGCTATTCGAGTTGTAGTGAGTCAGGGTATACTACAAGCAGAAGTCATGGTAAAA TGGTCATCCGTCGGTACTTGTGGATTTAAAGGTACGAGAAGAGGGACATCATTTGCTGCTCAAATCGCAACAAGAAACGCTATTCGAGTTGTAGTGAGTCAGGGTATACTACAAGCAGAAGTCATGGTAAAA WSSVGTCGFKGTRRGTSFAAQIATRNAIRVVVSQGILQAEVMVK Homology
BLAST of MC01g1587 vs. ExPASy Swiss-Prot
Match: Q3V501 (30S ribosomal protein S11, chloroplastic OS=Acorus calamus OX=4465 GN=rps11 PE=3 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 6.0e-11 Identity = 33/44 (75.00%), Postives = 36/44 (81.82%), Query Frame = 0
BLAST of MC01g1587 vs. ExPASy Swiss-Prot
Match: Q0G9S9 (30S ribosomal protein S11, chloroplastic OS=Daucus carota OX=4039 GN=rps11 PE=3 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 6.0e-11 Identity = 33/44 (75.00%), Postives = 36/44 (81.82%), Query Frame = 0
BLAST of MC01g1587 vs. ExPASy Swiss-Prot
Match: A0ZZ68 (30S ribosomal protein S11, chloroplastic OS=Gossypium barbadense OX=3634 GN=rps11 PE=3 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 6.0e-11 Identity = 33/44 (75.00%), Postives = 36/44 (81.82%), Query Frame = 0
BLAST of MC01g1587 vs. ExPASy Swiss-Prot
Match: Q2L937 (30S ribosomal protein S11, chloroplastic OS=Gossypium hirsutum OX=3635 GN=rps11 PE=3 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 6.0e-11 Identity = 33/44 (75.00%), Postives = 36/44 (81.82%), Query Frame = 0
BLAST of MC01g1587 vs. ExPASy Swiss-Prot
Match: Q6EW19 (30S ribosomal protein S11, chloroplastic OS=Nymphaea alba OX=34301 GN=rps11 PE=3 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 6.0e-11 Identity = 33/44 (75.00%), Postives = 36/44 (81.82%), Query Frame = 0
BLAST of MC01g1587 vs. NCBI nr
Match: YP_008965565.1 (ribosomal protein S11 [Conopholis americana] >CDI02734.1 ribosomal protein S11 [Conopholis americana]) HSP 1 Score: 72.8 bits (177), Expect = 9.98e-15 Identity = 34/44 (77.27%), Postives = 39/44 (88.64%), Query Frame = 0
BLAST of MC01g1587 vs. NCBI nr
Match: TYJ37027.1 (hypothetical protein E1A91_A05G348000v1 [Gossypium mustelinum]) HSP 1 Score: 71.6 bits (174), Expect = 3.03e-14 Identity = 35/44 (79.55%), Postives = 38/44 (86.36%), Query Frame = 0
BLAST of MC01g1587 vs. NCBI nr
Match: AGW04472.1 (ribosomal protein S11 [Astephanus triflorus]) HSP 1 Score: 71.2 bits (173), Expect = 4.01e-14 Identity = 35/44 (79.55%), Postives = 37/44 (84.09%), Query Frame = 0
BLAST of MC01g1587 vs. NCBI nr
Match: YP_009432840.1 (ribosomal protein S11 [Cassytha filiformis] >QWL22912.1 ribosomal protein S11 [Cassytha capillaris] >ATL22037.1 ribosomal protein S11 [Cassytha filiformis] >AUN45124.1 ribosomal protein S11 [Cassytha filiformis] >AXV54161.1 ribosomal protein S11 [Cassytha filiformis] >QWL21265.1 ribosomal protein S11 [Cassytha filiformis]) HSP 1 Score: 70.1 bits (170), Expect = 9.43e-14 Identity = 34/44 (77.27%), Postives = 37/44 (84.09%), Query Frame = 0
BLAST of MC01g1587 vs. NCBI nr
Match: ATL22086.1 (ribosomal protein S11 [Cassytha capillaris] >QWL22063.1 ribosomal protein S11 [Cassytha capillaris] >QWL22521.1 ribosomal protein S11 [Cassytha capillaris]) HSP 1 Score: 70.1 bits (170), Expect = 9.43e-14 Identity = 34/44 (77.27%), Postives = 37/44 (84.09%), Query Frame = 0
BLAST of MC01g1587 vs. ExPASy TrEMBL
Match: V6AQI7 (Ribosomal protein S11 OS=Conopholis americana OX=4179 GN=rps11 PE=3 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 4.83e-15 Identity = 34/44 (77.27%), Postives = 39/44 (88.64%), Query Frame = 0
BLAST of MC01g1587 vs. ExPASy TrEMBL
Match: A0A5D2ZDD3 (Uncharacterized protein OS=Gossypium mustelinum OX=34275 GN=E1A91_A05G348000v1 PE=3 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 1.47e-14 Identity = 35/44 (79.55%), Postives = 38/44 (86.36%), Query Frame = 0
BLAST of MC01g1587 vs. ExPASy TrEMBL
Match: U3MBC6 (Ribosomal protein S11 OS=Astephanus triflorus OX=157404 GN=rps11 PE=3 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 1.94e-14 Identity = 35/44 (79.55%), Postives = 37/44 (84.09%), Query Frame = 0
BLAST of MC01g1587 vs. ExPASy TrEMBL
Match: A0A291PSK8 (30S ribosomal protein S11, chloroplastic OS=Cassytha filiformis OX=121073 GN=rps11 PE=3 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 4.57e-14 Identity = 34/44 (77.27%), Postives = 37/44 (84.09%), Query Frame = 0
BLAST of MC01g1587 vs. ExPASy TrEMBL
Match: A0A291PSP0 (30S ribosomal protein S11, chloroplastic OS=Cassytha capillaris OX=1225354 GN=rps11 PE=3 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 4.57e-14 Identity = 34/44 (77.27%), Postives = 37/44 (84.09%), Query Frame = 0
BLAST of MC01g1587 vs. TAIR 10
Match: ATCG00750.1 (ribosomal protein S11 ) HSP 1 Score: 63.5 bits (153), Expect = 4.7e-11 Identity = 31/44 (70.45%), Postives = 35/44 (79.55%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|