![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MC01g0693 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.CAGAACGATGCCTTGCTTAACGTCCAAAAGCCTGGTGGCTGGGAACCAATTAAGAACATCAATGACCCATATGTTCAAGAGTTGGGAAGGTTTGCAGTGATGGAGCATACACATAACCTTTGTGGGGCATCGTACGAGTTCATCCGTGTCGTGAGCGGTGAGTCTCAGGTGGTGGGCGGGAAAAAATACTGCCTTGTGATCGAGGTGAAAGAGACGATAATAATTCCGAGTATGCCGAGTTCCATCAAGTTTTTCAAGGCTATTATGCTGGACAAGGCATGGGAGAAGTCCTGGGCGCTCTTATCCTTTGTGCCTTGC CAGAACGATGCCTTGCTTAACGTCCAAAAGCCTGGTGGCTGGGAACCAATTAAGAACATCAATGACCCATATGTTCAAGAGTTGGGAAGGTTTGCAGTGATGGAGCATACACATAACCTTTGTGGGGCATCGTACGAGTTCATCCGTGTCGTGAGCGGTGAGTCTCAGGTGGTGGGCGGGAAAAAATACTGCCTTGTGATCGAGGTGAAAGAGACGATAATAATTCCGAGTATGCCGAGTTCCATCAAGTTTTTCAAGGCTATTATGCTGGACAAGGCATGGGAGAAGTCCTGGGCGCTCTTATCCTTTGTGCCTTGC CAGAACGATGCCTTGCTTAACGTCCAAAAGCCTGGTGGCTGGGAACCAATTAAGAACATCAATGACCCATATGTTCAAGAGTTGGGAAGGTTTGCAGTGATGGAGCATACACATAACCTTTGTGGGGCATCGTACGAGTTCATCCGTGTCGTGAGCGGTGAGTCTCAGGTGGTGGGCGGGAAAAAATACTGCCTTGTGATCGAGGTGAAAGAGACGATAATAATTCCGAGTATGCCGAGTTCCATCAAGTTTTTCAAGGCTATTATGCTGGACAAGGCATGGGAGAAGTCCTGGGCGCTCTTATCCTTTGTGCCTTGC QNDALLNVQKPGGWEPIKNINDPYVQELGRFAVMEHTHNLCGASYEFIRVVSGESQVVGGKKYCLVIEVKETIIIPSMPSSIKFFKAIMLDKAWEKSWALLSFVPC Homology
BLAST of MC01g0693 vs. ExPASy Swiss-Prot
Match: Q10Q46 (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 4.2e-10 Identity = 35/93 (37.63%), Postives = 48/93 (51.61%), Query Frame = 0
BLAST of MC01g0693 vs. ExPASy Swiss-Prot
Match: Q10J94 (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 4.2e-10 Identity = 34/94 (36.17%), Postives = 50/94 (53.19%), Query Frame = 0
BLAST of MC01g0693 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 63.5 bits (153), Expect = 1.6e-09 Identity = 38/94 (40.43%), Postives = 49/94 (52.13%), Query Frame = 0
BLAST of MC01g0693 vs. ExPASy Swiss-Prot
Match: Q10Q47 (Putative cysteine proteinase inhibitor 7 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210100 PE=3 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 1.4e-08 Identity = 29/61 (47.54%), Postives = 36/61 (59.02%), Query Frame = 0
BLAST of MC01g0693 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 59.3 bits (142), Expect = 3.0e-08 Identity = 33/92 (35.87%), Postives = 50/92 (54.35%), Query Frame = 0
BLAST of MC01g0693 vs. NCBI nr
Match: XP_022132557.1 (cysteine proteinase inhibitor 6-like [Momordica charantia]) HSP 1 Score: 219 bits (559), Expect = 6.00e-72 Identity = 106/106 (100.00%), Postives = 106/106 (100.00%), Query Frame = 0
BLAST of MC01g0693 vs. NCBI nr
Match: WP_198843152.1 (hypothetical protein, partial [Aureibaculum sp. A20] >MBJ2176574.1 hypothetical protein [Aureibaculum sp. A20]) HSP 1 Score: 125 bits (313), Expect = 2.02e-34 Identity = 67/110 (60.91%), Postives = 84/110 (76.36%), Query Frame = 0
BLAST of MC01g0693 vs. NCBI nr
Match: XP_023543511.1 (cysteine proteinase inhibitor 5-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 124 bits (310), Expect = 6.69e-34 Identity = 63/106 (59.43%), Postives = 78/106 (73.58%), Query Frame = 0
BLAST of MC01g0693 vs. NCBI nr
Match: XP_038882290.1 (cysteine proteinase inhibitor 5-like [Benincasa hispida]) HSP 1 Score: 120 bits (301), Expect = 1.20e-32 Identity = 67/108 (62.04%), Postives = 83/108 (76.85%), Query Frame = 0
BLAST of MC01g0693 vs. NCBI nr
Match: KAG6604292.1 (putative cysteine proteinase inhibitor 7, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 120 bits (300), Expect = 2.21e-32 Identity = 63/106 (59.43%), Postives = 77/106 (72.64%), Query Frame = 0
BLAST of MC01g0693 vs. ExPASy TrEMBL
Match: A0A6J1BU61 (cysteine proteinase inhibitor 6-like OS=Momordica charantia OX=3673 GN=LOC111005388 PE=4 SV=1) HSP 1 Score: 219 bits (559), Expect = 2.91e-72 Identity = 106/106 (100.00%), Postives = 106/106 (100.00%), Query Frame = 0
BLAST of MC01g0693 vs. ExPASy TrEMBL
Match: A0A6J1BX23 (cysteine proteinase inhibitor 5-like OS=Momordica charantia OX=3673 GN=LOC111005501 PE=4 SV=1) HSP 1 Score: 117 bits (293), Expect = 3.20e-31 Identity = 67/110 (60.91%), Postives = 82/110 (74.55%), Query Frame = 0
BLAST of MC01g0693 vs. ExPASy TrEMBL
Match: A0A6J1GCT2 (uncharacterized protein LOC111453027 OS=Cucurbita moschata OX=3662 GN=LOC111453027 PE=4 SV=1) HSP 1 Score: 115 bits (289), Expect = 5.02e-31 Identity = 62/106 (58.49%), Postives = 75/106 (70.75%), Query Frame = 0
BLAST of MC01g0693 vs. ExPASy TrEMBL
Match: A0A6J1BUK6 (cysteine proteinase inhibitor 5-like OS=Momordica charantia OX=3673 GN=LOC111005500 PE=4 SV=1) HSP 1 Score: 114 bits (284), Expect = 3.24e-30 Identity = 66/111 (59.46%), Postives = 81/111 (72.97%), Query Frame = 0
BLAST of MC01g0693 vs. ExPASy TrEMBL
Match: A0A6J1FCN5 (cysteine proteinase inhibitor 8-like OS=Cucurbita moschata OX=3662 GN=LOC111442890 PE=4 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 1.09e-22 Identity = 51/108 (47.22%), Postives = 69/108 (63.89%), Query Frame = 0
BLAST of MC01g0693 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 63.5 bits (153), Expect = 1.1e-10 Identity = 38/94 (40.43%), Postives = 49/94 (52.13%), Query Frame = 0
BLAST of MC01g0693 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 57.0 bits (136), Expect = 1.1e-08 Identity = 33/92 (35.87%), Postives = 51/92 (55.43%), Query Frame = 0
BLAST of MC01g0693 vs. TAIR 10
Match: AT2G31980.1 (PHYTOCYSTATIN 2 ) HSP 1 Score: 43.1 bits (100), Expect = 1.6e-04 Identity = 27/89 (30.34%), Postives = 39/89 (43.82%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|